SecReT6
Protein ID: 283779611
SecReT6 ID376
T6SS typei3
Gene symbol-
Locus tagPsta_1832
StrainPirellula staleyi DSM 6068
Repliconchromosome [GenBank: NC_013720] [Browse all T6SS(s) in this replicon]
Location [Strand]2322701..2324200 [+]
Producttype VI secretion protein EvpB
NoteTssC
UniProt IDD2QZM3
KEGG IDpsl:Psta_1832
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 7.10E-196, Aligned region: 68..494
Protein Sequence: 499 a.a.     [Download]
>gi|283779611|ref|YP_003370366.1| type VI secretion protein EvpB [Pirellula staleyi DSM 6068]
MSMDPSLQSAQQGAETTFASSDFSSLLQKEFKPKSDRAKEAVESAVKTLAQQALEGTAVVSDDAIKTIQA
IIASIDQKLSEQVNLILHNPDFQQLEGAWRGLHYLVNNTETDEMLKIRVFNISKKELGKTLKKFKGTAWD
QSPIFKKMYEEEYGQFGGEPYGCLVGDYHFDHSPPDVELLGEISKVCAAAHAPFIAGASPTLMQMDSWQE
LSNPRDLTKIFGTAEYAPWRSLRESDDSRYIGLAMPRFLSRLPYGAKTDPVSEFDFEEDVENADHSKYTW
SNAAYAMATNINRSFKLYGWCSRIRGIESGGAVEGLPCHTFPTDDGGVDMKCPTEIAISDRREAELAKNG
FMPLVHKKNSDFAAFIGAQSLQKPQEYDDPDATANANLSARLPYLFATCRFAHYLKCIVRDKLGSFKEKE
DMQGWLNRWVSNYIEYNPKLASEEDKARRPLAAAEVTVEEVEGNPGYYSSKMFLRPHYQLEGLTVSLRLV
SKLPSGKGG
 
Nucleotide Sequence: 1500 bp     [Download]
>gi|283777802|ref|NC_013720.1|:2322701-2324200 Pirellula staleyi DSM 6068 chromosome, complete genome
ATGTCGATGGATCCCAGTTTGCAGTCAGCCCAGCAAGGTGCCGAAACCACCTTCGCTTCGAGCGATTTTT
CGTCGCTCCTCCAAAAAGAATTCAAACCCAAGAGCGATCGTGCTAAGGAAGCCGTTGAGTCGGCTGTAAA
GACCTTGGCTCAGCAAGCTCTCGAAGGGACCGCTGTTGTTTCCGACGACGCGATCAAGACGATCCAGGCC
ATCATCGCCTCGATCGATCAGAAGCTCTCGGAACAGGTCAACCTGATTCTGCACAACCCTGATTTTCAGC
AGCTCGAAGGTGCCTGGCGTGGTTTGCACTACCTCGTCAACAACACCGAAACCGACGAAATGCTGAAGAT
CCGCGTCTTCAACATCTCGAAGAAAGAACTCGGCAAGACGCTCAAGAAGTTCAAGGGAACGGCTTGGGAT
CAGAGCCCGATCTTCAAGAAGATGTATGAAGAAGAATACGGCCAATTCGGTGGCGAGCCCTACGGCTGCC
TCGTGGGTGATTATCACTTCGATCACAGCCCACCCGATGTCGAATTGCTCGGCGAAATCTCGAAGGTTTG
CGCCGCTGCTCACGCTCCGTTCATCGCCGGTGCTTCCCCCACGCTCATGCAAATGGATTCGTGGCAGGAA
CTCTCGAACCCTCGCGATCTGACCAAGATCTTCGGCACCGCCGAATACGCTCCTTGGCGTTCGCTCCGCG
AATCGGACGATTCACGCTACATCGGCCTAGCGATGCCACGCTTCCTCTCGCGATTGCCTTACGGCGCGAA
GACCGACCCAGTCTCGGAATTCGACTTCGAAGAGGATGTCGAGAACGCTGATCACAGCAAGTACACCTGG
TCGAACGCTGCTTACGCGATGGCCACGAACATCAACCGTTCGTTCAAGCTCTACGGCTGGTGCTCGCGTA
TTCGCGGTATCGAATCGGGCGGTGCCGTGGAAGGCTTGCCTTGCCATACGTTCCCCACCGACGACGGTGG
CGTGGACATGAAGTGCCCCACCGAAATCGCGATCAGCGACCGCCGCGAAGCGGAACTCGCCAAAAACGGT
TTCATGCCACTCGTGCACAAGAAGAACTCGGACTTCGCCGCGTTCATTGGTGCTCAGTCGCTCCAGAAGC
CACAGGAATACGACGATCCCGATGCCACGGCCAACGCCAACCTGTCGGCCCGTCTCCCTTACTTGTTTGC
CACTTGCCGCTTCGCTCACTATCTCAAGTGCATCGTTCGCGACAAACTGGGTTCATTCAAAGAAAAGGAA
GACATGCAGGGTTGGCTCAACCGCTGGGTGTCGAACTACATCGAATACAACCCGAAGCTCGCTTCGGAAG
AAGACAAAGCTCGCCGCCCACTCGCTGCAGCTGAAGTGACCGTCGAAGAAGTGGAAGGTAACCCAGGTTA
CTACTCTTCGAAGATGTTCCTCCGCCCCCACTACCAGCTGGAAGGTTTGACCGTGTCGCTGCGACTCGTG
TCGAAACTCCCATCGGGCAAGGGTGGTTAG