SecReT6
Protein ID: 283779612
SecReT6 ID376
T6SS typei3
Gene symbol-
Locus tagPsta_1833
StrainPirellula staleyi DSM 6068
Repliconchromosome [GenBank: NC_013720] [Browse all T6SS(s) in this replicon]
Location [Strand]2324881..2325381 [+]
Producthypothetical protein
NoteTssD
UniProt IDD2QZM4
KEGG IDpsl:Psta_1833
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 3.00E-20, Aligned region: 4..138
Protein Sequence: 166 a.a.     [Download]
>gi|283779612|ref|YP_003370367.1| hypothetical protein Psta_1833 [Pirellula staleyi DSM 6068]
MILLKLDGVTGDSQIPGYEDWIACTSCSWNIERTFSESAKAGTLDVNVGVAEIPPITLGKSFDVASVYLM
QNAIAGGALGTAAQIHFLSTSGTEGTGAIYLEYKLFNPIVASWSISGDEDERPTEEVTLWYWKIWMQYYA
STDGKNYVGKGNKGWDRTKNKSWDGK
 
Nucleotide Sequence: 501 bp     [Download]
>gi|283777802|ref|NC_013720.1|:2324881-2325381 Pirellula staleyi DSM 6068 chromosome, complete genome
ATGATTCTGCTCAAACTTGATGGTGTTACCGGCGACTCGCAGATCCCAGGTTACGAAGACTGGATTGCCT
GCACCAGCTGCAGCTGGAACATTGAACGTACGTTTTCGGAATCGGCCAAGGCTGGTACCCTCGACGTGAA
CGTCGGTGTTGCTGAAATCCCACCAATTACCCTCGGCAAGTCGTTTGACGTGGCGAGCGTCTACCTGATG
CAAAACGCCATCGCTGGCGGTGCTCTGGGAACCGCTGCTCAGATCCACTTCCTCAGCACTTCGGGTACCG
AAGGCACTGGCGCTATCTACCTCGAATACAAACTGTTCAATCCGATTGTGGCCAGCTGGAGCATCAGCGG
CGACGAAGATGAACGTCCGACGGAAGAAGTGACCCTGTGGTACTGGAAGATTTGGATGCAGTACTACGCC
TCGACCGACGGTAAGAACTACGTCGGTAAGGGTAACAAGGGTTGGGATCGTACCAAGAACAAGTCGTGGG
ACGGCAAGTAA