SecReT6
Protein ID: 283779613
SecReT6 ID376
T6SS typei3
Gene symbol-
Locus tagPsta_1834
StrainPirellula staleyi DSM 6068
Repliconchromosome [GenBank: NC_013720] [Browse all T6SS(s) in this replicon]
Location [Strand]2325729..2326658 [+]
Productvirulence protein SciE type
NoteTagJ
UniProt IDD2QZM5
KEGG IDpsl:Psta_1834
PDB IDNA
Domain hit(s) vs Pfam ImpE [PF07024], Evalue: 1.30E-43, Aligned region: 152..273
TPR_19 [PF14559], Evalue: 0.0013, Aligned region: 8..55
TPR_16 [PF13432], Evalue: 0.0079, Aligned region: 7..53
Protein Sequence: 309 a.a.     [Download]
>gi|283779613|ref|YP_003370368.1| virulence protein SciE type [Pirellula staleyi DSM 6068]
MDALSTLRDGNLDTALAELSQKIRSNPGDPKLRVFLFQLLCVQGQWDRALTQLGVSGDMDPIAMPMVQTY
REAIRCELLRSDIFTGKRTPLIFGEPEEWIALLMQSLEQTAKGHIAEGETLRQQAFELAPVTSGVIKTAN
RVPEGESESFTETPFEWLSDADSRLGPIIEAIVNGRYYWIPLHRIRRIDVEKPEDLRDYVWTPVHFQWAN
GGEVVGLVPTRYPLTFNSTDPLLKLSRKTEWNEIAEGVYHGLGQRMLTTDAGDYALMDVRQIRLDVALDA
SMKSPEEAVALDVSPELRAGSVDGESTDG
 
Nucleotide Sequence: 930 bp     [Download]
>gi|283777802|ref|NC_013720.1|:2325729-2326658 Pirellula staleyi DSM 6068 chromosome, complete genome
GTGGACGCCCTCAGTACCCTTCGCGATGGCAATCTCGACACCGCTCTAGCCGAATTGAGCCAGAAAATCC
GCAGCAATCCGGGTGATCCCAAGCTGCGAGTTTTTCTCTTTCAGTTGCTTTGCGTTCAAGGCCAATGGGA
TCGCGCTCTCACGCAACTCGGCGTCTCGGGCGATATGGACCCGATCGCGATGCCGATGGTGCAGACCTAT
CGGGAAGCGATTCGCTGCGAACTTTTGCGAAGCGACATTTTCACCGGCAAACGCACACCGCTGATCTTCG
GCGAACCGGAGGAATGGATCGCGCTGCTGATGCAGTCGCTCGAGCAAACGGCGAAGGGTCACATCGCTGA
GGGGGAAACGCTCCGCCAACAAGCGTTCGAGCTCGCTCCCGTCACTTCCGGCGTGATCAAAACGGCGAAT
CGAGTTCCCGAAGGGGAGAGCGAGTCGTTCACCGAAACCCCGTTTGAATGGCTCTCGGACGCCGATTCGC
GTCTCGGTCCGATCATCGAAGCGATCGTGAACGGCCGCTATTACTGGATTCCTCTGCATCGCATTCGCCG
CATCGATGTCGAGAAACCCGAGGATTTGCGCGACTACGTTTGGACGCCGGTCCATTTCCAGTGGGCCAAT
GGTGGTGAAGTGGTGGGGCTCGTCCCCACACGCTATCCGCTGACCTTCAACAGCACCGATCCACTGCTGA
AGCTCTCGCGCAAGACTGAGTGGAACGAAATTGCCGAAGGGGTTTACCACGGCCTCGGGCAACGAATGCT
CACCACCGATGCCGGCGACTATGCTCTGATGGATGTGCGACAAATTCGCCTCGATGTGGCTCTCGATGCG
TCGATGAAGAGCCCTGAAGAAGCGGTCGCCCTCGACGTTTCGCCAGAACTACGGGCCGGTAGCGTCGACG
GAGAGTCCACGGATGGCTGA