SecReT6
Protein ID: 283779614
SecReT6 ID376
T6SS typei3
Gene symbol-
Locus tagPsta_1835
StrainPirellula staleyi DSM 6068
Repliconchromosome [GenBank: NC_013720] [Browse all T6SS(s) in this replicon]
Location [Strand]2326651..2327154 [+]
Producttype VI secretion system lysozyme-like protein
NoteTssE
UniProt IDD2QZM6
KEGG IDpsl:Psta_1835
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 1.60E-22, Aligned region: 36..145
Protein Sequence: 167 a.a.     [Download]
>gi|283779614|ref|YP_003370369.1| type VI secretion system lysozyme-like protein [Pirellula staleyi DSM 6068]
MAELTTQERLQPSLLDRLTDEEPQQGQESRNRRVLSLQRLRESVLRDLAWLLNTTNLGDRTLEYEAPFVE
SSVLNYGVPDFAGLTSSSVDGGQLQRLVKQAIWNFEPRILRETLEVNISADGGRMDQNSLIFEISGELWA
QPVPLELFLKTQVDLETGSISIADFVR
 
Nucleotide Sequence: 504 bp     [Download]
>gi|283777802|ref|NC_013720.1|:2326651-2327154 Pirellula staleyi DSM 6068 chromosome, complete genome
ATGGCTGAGTTAACCACGCAAGAGCGTTTGCAGCCGTCGCTCCTCGATCGGCTTACTGATGAAGAGCCGC
AGCAAGGACAGGAATCTCGCAATCGGCGCGTGTTGTCGCTGCAACGTTTGCGCGAAAGTGTGCTTCGCGA
TCTTGCCTGGCTCCTGAACACCACGAATCTCGGTGACCGAACCCTGGAGTACGAAGCCCCGTTTGTTGAA
TCGTCGGTGCTGAACTATGGGGTGCCCGATTTCGCGGGGCTCACCAGCAGCAGCGTCGACGGGGGCCAGT
TGCAGCGACTGGTGAAGCAAGCGATCTGGAATTTCGAGCCCCGCATTCTGCGCGAGACACTCGAAGTGAA
CATCAGCGCCGATGGTGGCCGGATGGACCAAAACAGTTTGATTTTTGAGATTTCGGGAGAGCTCTGGGCC
CAGCCGGTGCCGCTCGAATTGTTCCTCAAGACCCAAGTAGACCTCGAAACTGGAAGTATCTCGATTGCCG
ACTTTGTCCGTTGA