SecReT6
Protein ID: 283779615
SecReT6 ID376
T6SS typei3
Gene symbol-
Locus tagPsta_1836
StrainPirellula staleyi DSM 6068
Repliconchromosome [GenBank: NC_013720] [Browse all T6SS(s) in this replicon]
Location [Strand]2327220..2329097 [+]
Producttype VI secretion protein
NoteTssF
UniProt IDD2QZM7
KEGG IDpsl:Psta_1836
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 5.40E-219, Aligned region: 5..623
Protein Sequence: 625 a.a.     [Download]
>gi|283779615|ref|YP_003370370.1| type VI secretion protein [Pirellula staleyi DSM 6068]
MDPRLLKFYNRELQHLREMGAEFASEFPKIAGRLTLDGFECVDPYVERLLEGFAFLAARVQLRIDSEFPR
FTQHLFEIVYPHYLAPTPSMAVVQFEPDLKVGALADGYTIPRGESIRSLLGKGETTACEYRTAQDCTLWP
LEIVEAEYFSRDAASIEVPNVAGLKAGIRLRIRTTAGLKFKDTKLDRLTLFLRGAGDLPMHLYEQILGNP
LGFVVRPTTRPIPWQVVNEASKIQPRGFAENEALLPYGPRSFQGYRLLQEYFAFPQRYLFVDLTGLKSAV
SRCEEQELDIIILLSRAEQRLESYVSAESFSLHCTPAINLFPKSADRIHLSDKFSEHHVIPDRTRPMDFE
VYEVKGIQGYGAEVEDEQTFFPFYASSDVNSGHDGMAYYTVHRLPRVLSTNQKKYGPRSSYIGSEVFVSL
VDGREAPYSHNLRQLAIDTLCTNRDLPLQMPVGKSTTDFTLDTGAPVNSVRCLSGPTRPKPSHSFGEGDF
VWRLISHLSLNYLSLVDGDERHGAAALRDILRLYGDANDAAIRKQIEGVRSVAARPITRRIPTPGPITFG
RGLEIAITCDEAAFEGSGVFLLGAVLEQFFARYVSINSFTETVVHSSDRGTVMRWPTRIGRRHTA
 
Nucleotide Sequence: 1878 bp     [Download]
>gi|283777802|ref|NC_013720.1|:2327220-2329097 Pirellula staleyi DSM 6068 chromosome, complete genome
ATGGATCCTCGGCTCCTCAAATTCTATAACCGCGAACTACAGCATCTCCGTGAGATGGGGGCGGAGTTCG
CATCGGAATTCCCCAAGATCGCCGGACGATTGACCCTCGATGGTTTCGAGTGCGTCGATCCCTACGTCGA
ACGATTGCTCGAGGGCTTTGCATTTCTTGCTGCTCGCGTTCAGCTCCGCATCGATTCGGAGTTCCCTCGC
TTTACGCAGCATTTGTTTGAAATTGTCTACCCGCACTATTTGGCTCCGACCCCCTCGATGGCTGTGGTGC
AGTTCGAGCCCGACTTGAAGGTCGGCGCGCTCGCCGATGGCTACACCATTCCGCGAGGTGAGTCGATTCG
CAGTTTGCTTGGCAAAGGGGAAACGACTGCCTGCGAATATCGCACTGCCCAAGACTGCACGCTGTGGCCC
CTCGAGATCGTCGAGGCGGAGTATTTCAGCCGCGATGCCGCTTCGATCGAAGTGCCGAATGTGGCAGGGC
TCAAGGCGGGCATTCGATTGCGGATTCGTACGACCGCTGGCCTCAAGTTCAAAGACACCAAACTCGATCG
TCTGACGTTGTTCCTGCGTGGCGCTGGCGATTTGCCGATGCACCTCTATGAGCAAATCTTGGGCAATCCG
CTTGGATTTGTCGTGCGTCCGACGACCCGCCCGATCCCGTGGCAAGTGGTGAATGAAGCGAGCAAGATCC
AGCCTCGCGGCTTTGCCGAGAACGAAGCGCTCCTCCCTTACGGCCCTCGATCGTTTCAAGGCTATCGGCT
GCTGCAAGAGTATTTTGCTTTTCCCCAGCGGTATCTGTTTGTCGATCTGACCGGGCTGAAGTCGGCCGTA
TCGCGCTGCGAAGAGCAAGAACTCGACATCATTATTCTGCTGTCGCGAGCCGAACAGCGTCTCGAGTCGT
ATGTCTCGGCCGAGTCGTTTTCGCTTCACTGCACCCCGGCGATCAACTTGTTTCCCAAGTCGGCTGATCG
TATTCACCTGAGCGACAAGTTCAGCGAGCATCACGTCATTCCCGATCGCACCCGTCCGATGGACTTCGAG
GTGTACGAAGTGAAGGGAATCCAAGGCTACGGCGCTGAAGTCGAAGATGAACAGACGTTCTTCCCGTTTT
ATGCCTCGAGCGACGTGAACTCGGGACACGACGGGATGGCCTACTACACGGTGCATCGTTTGCCACGTGT
GCTCTCGACGAATCAGAAAAAATACGGCCCCCGCTCGAGCTATATCGGCTCCGAAGTTTTTGTCTCCCTC
GTTGATGGTCGTGAAGCGCCATACTCTCACAATCTGCGGCAACTGGCCATCGATACGCTTTGCACGAATC
GCGATCTTCCGCTGCAAATGCCGGTGGGAAAGAGCACGACTGATTTCACGCTCGATACCGGAGCGCCGGT
GAATTCGGTTCGCTGCTTGTCGGGCCCCACACGCCCCAAACCCTCGCACAGCTTTGGCGAAGGGGATTTC
GTGTGGCGCTTGATCAGCCACTTGTCCCTGAATTATTTGTCGCTGGTCGATGGCGACGAGCGTCATGGGG
CGGCTGCGCTCCGCGATATCTTGCGGCTCTATGGCGATGCCAATGACGCTGCGATTCGGAAGCAAATCGA
AGGTGTGCGATCGGTGGCCGCCCGTCCAATCACTCGCCGCATTCCGACTCCGGGGCCGATCACGTTTGGT
CGTGGCCTCGAGATTGCAATCACCTGCGATGAAGCGGCGTTTGAAGGAAGTGGCGTCTTCCTGCTCGGCG
CTGTGCTCGAACAATTTTTCGCCCGTTACGTTTCGATCAACTCCTTTACTGAAACGGTCGTCCACTCGAG
CGACCGTGGCACTGTGATGCGATGGCCAACGAGAATCGGACGTCGACACACCGCGTAG