SecReT6
Protein ID: 283779616
SecReT6 ID376
T6SS typei3
Gene symbol-
Locus tagPsta_1837
StrainPirellula staleyi DSM 6068
Repliconchromosome [GenBank: NC_013720] [Browse all T6SS(s) in this replicon]
Location [Strand]2329061..2330098 [+]
Producttype VI secretion protein
NoteTssG
UniProt IDD2QZM8
KEGG IDpsl:Psta_1837
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 7.00E-111, Aligned region: 20..323
Protein Sequence: 345 a.a.     [Download]
>gi|283779616|ref|YP_003370371.1| type VI secretion protein [Pirellula staleyi DSM 6068]
MANENRTSTHRVELLKALAAAPHQFDFYQALRRIEAVFKDKPRIGESLRLADDPVRFAQEPSLIFAPSTI
AALEQGKQGHPPRLVVRHVGMFGPNGPLPLHLTEYARDRLRNSQDPTFVRFVDIFHHRMYSLFYRAWAVA
QPTTQFDRPESDRFADYVGSLFGIGMASMNDRDAMPDLAKLYFSGRFVCQTRHAEGLAAILNAFFSIPMV
LKEFVGQWLPLPMNCRTNLGLGSDTGVLGMSATIGERVWDCQQKFRIVAGPMDFRQYRRLLPQGESLASL
ISVVDNYVGLELDWDVNLILKKEEVPPIQLGSMGQLGWTSWLKSREREEDAADLILRPRAERTAA
 
Nucleotide Sequence: 1038 bp     [Download]
>gi|283777802|ref|NC_013720.1|:2329061-2330098 Pirellula staleyi DSM 6068 chromosome, complete genome
ATGGCCAACGAGAATCGGACGTCGACACACCGCGTAGAGCTGCTCAAAGCTCTCGCGGCGGCGCCCCATC
AATTCGATTTCTATCAGGCACTGCGTCGTATCGAAGCAGTGTTTAAGGACAAGCCGCGCATAGGTGAATC
GCTGCGATTGGCCGATGATCCCGTTCGTTTTGCCCAAGAGCCGAGCTTGATCTTCGCGCCATCGACCATC
GCCGCGCTCGAACAAGGAAAACAGGGACACCCGCCCCGCCTGGTTGTGCGTCATGTTGGCATGTTTGGAC
CCAACGGTCCCCTTCCACTGCACCTCACCGAATATGCCCGCGATCGACTTCGCAATTCGCAAGATCCGAC
ATTCGTTCGGTTTGTCGACATCTTCCATCATCGCATGTACTCGCTGTTCTACCGGGCCTGGGCCGTAGCA
CAGCCCACCACGCAGTTCGATCGTCCAGAATCCGATCGCTTTGCCGACTATGTTGGTTCGCTCTTCGGCA
TCGGCATGGCGTCGATGAACGATCGCGATGCAATGCCCGATTTGGCCAAGCTCTACTTCAGTGGGCGCTT
TGTCTGTCAAACGCGTCATGCCGAAGGTTTAGCGGCGATTTTGAATGCGTTCTTCTCGATCCCGATGGTC
CTCAAAGAGTTCGTGGGTCAGTGGCTGCCGCTGCCGATGAACTGCCGCACCAATCTCGGTCTCGGCAGTG
ATACCGGTGTGCTGGGGATGAGCGCGACGATTGGCGAACGGGTGTGGGATTGTCAGCAGAAGTTTCGCAT
CGTGGCTGGTCCGATGGATTTCCGTCAGTACCGGCGTTTGCTACCCCAGGGAGAAAGTCTCGCGTCGCTC
ATTTCGGTGGTCGACAACTACGTCGGTCTGGAACTCGATTGGGATGTGAATCTGATTCTGAAAAAGGAAG
AAGTTCCCCCGATCCAGCTCGGAAGTATGGGGCAACTTGGGTGGACCTCGTGGCTGAAGAGCCGCGAGCG
TGAAGAGGACGCTGCAGATTTGATTTTGCGTCCCCGGGCGGAACGGACTGCTGCTTAG