SecReT6
Protein ID: 283779617
SecReT6 ID376
T6SS typei3
Gene symbol-
Locus tagPsta_1838
StrainPirellula staleyi DSM 6068
Repliconchromosome [GenBank: NC_013720] [Browse all T6SS(s) in this replicon]
Location [Strand]2330288..2333035 [+]
Producttype VI secretion ATPase, ClpV1 family
NoteTssH
UniProt IDD2QZM9
KEGG IDpsl:Psta_1838
PDB IDNA
Domain hit(s) vs Pfam AAA_2 [PF07724], Evalue: 2.30E-37, Aligned region: 280..280
AAA_2 [PF07724], Evalue: 2.30E-37, Aligned region: 647..813
AAA [PF00004], Evalue: 5.60E-19, Aligned region: 236..369
AAA [PF00004], Evalue: 5.60E-19, Aligned region: 653..736
AAA_16 [PF13191], Evalue: 1.10E-14, Aligned region: 36..82
AAA_16 [PF13191], Evalue: 1.10E-14, Aligned region: 213..256
AAA_16 [PF13191], Evalue: 1.10E-14, Aligned region: 280..314
AAA_16 [PF13191], Evalue: 1.10E-14, Aligned region: 624..697
AAA_16 [PF13191], Evalue: 1.10E-14, Aligned region: 716..736
ClpB_D2-small [PF10431], Evalue: 1.90E-14, Aligned region: 820..894
AAA_5 [PF07728], Evalue: 1.60E-10, Aligned region: 236..256
AAA_5 [PF07728], Evalue: 1.60E-10, Aligned region: 334..366
AAA_5 [PF07728], Evalue: 1.60E-10, Aligned region: 652..766
AAA_22 [PF13401], Evalue: 7.60E-08, Aligned region: 63..77
AAA_22 [PF13401], Evalue: 7.60E-08, Aligned region: 235..332
AAA_22 [PF13401], Evalue: 7.60E-08, Aligned region: 370..402
AAA_22 [PF13401], Evalue: 7.60E-08, Aligned region: 650..685
AAA_25 [PF13481], Evalue: 3.20E-06, Aligned region: 230..313
AAA_25 [PF13481], Evalue: 3.20E-06, Aligned region: 650..677
Sigma54_activat [PF00158], Evalue: 7.30E-06, Aligned region: 215..250
Sigma54_activat [PF00158], Evalue: 7.30E-06, Aligned region: 623..763
AAA_14 [PF13173], Evalue: 1.60E-05, Aligned region: 236..333
AAA_14 [PF13173], Evalue: 1.60E-05, Aligned region: 651..767
AAA_19 [PF13245], Evalue: 2.30E-05, Aligned region: 236..257
AAA_19 [PF13245], Evalue: 2.30E-05, Aligned region: 650..675
AAA_19 [PF13245], Evalue: 2.30E-05, Aligned region: 823..841
NACHT [PF05729], Evalue: 2.80E-05, Aligned region: 236..334
NACHT [PF05729], Evalue: 2.80E-05, Aligned region: 652..681
Zeta_toxin [PF06414], Evalue: 3.30E-05, Aligned region: 123..157
Zeta_toxin [PF06414], Evalue: 3.30E-05, Aligned region: 236..256
Zeta_toxin [PF06414], Evalue: 3.30E-05, Aligned region: 646..692
Arch_ATPase [PF01637], Evalue: 3.80E-05, Aligned region: 214..253
Arch_ATPase [PF01637], Evalue: 3.80E-05, Aligned region: 288..320
Arch_ATPase [PF01637], Evalue: 3.80E-05, Aligned region: 651..686
Arch_ATPase [PF01637], Evalue: 3.80E-05, Aligned region: 719..734
AAA_17 [PF13207], Evalue: 0.0003, Aligned region: 236..256
AAA_17 [PF13207], Evalue: 0.0003, Aligned region: 652..688
AAA_18 [PF13238], Evalue: 0.00033, Aligned region: 236..255
AAA_18 [PF13238], Evalue: 0.00033, Aligned region: 653..680
IstB_IS21 [PF01695], Evalue: 0.00044, Aligned region: 219..254
IstB_IS21 [PF01695], Evalue: 0.00044, Aligned region: 652..681
AAA_29 [PF13555], Evalue: 0.0006, Aligned region: 228..251
AAA_29 [PF13555], Evalue: 0.0006, Aligned region: 650..677
ResIII [PF04851], Evalue: 0.009, Aligned region: 220..257
ResIII [PF04851], Evalue: 0.009, Aligned region: 296..317
ResIII [PF04851], Evalue: 0.009, Aligned region: 652..679
Protein Sequence: 915 a.a.     [Download]
>gi|283779617|ref|YP_003370372.1| type VI secretion ATPase, ClpV1 family [Pirellula staleyi DSM 6068]
MAEISRVALFGKLNSLAYRAIEAATVFCKMRGNPYVELAHWLHQILQLPDSDVHKIIKQFNLEPSRLARD
LTETLDRFPRGSSSISDLSSHLEDATQQGWVYATLMFKDSQVRTGYLIVGMIKTKTLNNALLSISKEFGK
INADTLIDKFAEVVAGSPEDSLRASDGTQVGGGAVPGEASGAMAPAAMGKQEALKQFSIDLTERARKGEI
DPIVGRDEEIRQLVDILMRRRQNNPILTGEAGVGKTAVVEGFALRIASGDVPPSLKDVSLRSLDIGLLQA
GASMKGEFENRLRQVIEEVQSSEQPIILFIDEAHTLIGAGGAAGTGDAANLLKPALARGKLRTVAATTWA
EYKKHIEKDPALTRRFQVVQVGEPSEDKAILMMRGMASTLEQHHRVQILDEALEASVRLSHRYIPARQLP
DKSVSLLDTTCARVAISQHAVPAEVEDCRRKIEALEVEQGIIAREKAVGVDTTKREKEVDSKLAIERERL
KGLEQRWTDEKTLVDEILDIRGKLRGQTGKVEGTHSKLEKAADKAAKEAPPVAAPTPPLTEAERAPLLAK
LTELQAKLTALQGESPLILPTVDEQAVASVVADWTGIPVGRMVKNEVEAVLKLAETLGQRVIGQDHAMKM
IARRIQTSRAQLENPNKPIGVFLLAGTSGVGKTETALALAEALYGGEQNVITINMSEFQEAHTVSTLKGS
PPGYVGYGEGGILTEAVRRKPYSVVLLDEVEKAHGDVHELFFQVFDKGWMEDGEGRVIDFKNTLILLTSN
AGSDLIMNMCKDPELLPDPEAIAKSLRDPLLKVFPAALLGRLVTIPYYPLSDSMIAAITRLQLRRIEKRI
GVNHKVPFTYSDEVLKLIVSRCTELESGGRMIDSILTNTMLPAISEEILKRMMVGSAVKKIEITAKGSEF
HYNFD
 
Nucleotide Sequence: 2748 bp     [Download]
>gi|283777802|ref|NC_013720.1|:2330288-2333035 Pirellula staleyi DSM 6068 chromosome, complete genome
ATGGCTGAGATTAGTCGCGTAGCCCTTTTTGGAAAACTTAACAGCCTCGCTTATCGCGCGATTGAGGCCG
CCACCGTCTTTTGCAAGATGCGTGGCAATCCTTACGTCGAGTTGGCTCACTGGCTGCATCAGATTCTGCA
GCTTCCCGATTCTGACGTGCACAAAATCATTAAGCAGTTCAATCTCGAGCCAAGTCGTTTGGCGCGTGAT
CTGACCGAAACACTCGATCGTTTTCCACGCGGCAGTTCCAGCATCTCGGACCTTTCGAGCCATCTCGAAG
ATGCGACTCAGCAAGGCTGGGTCTATGCCACGCTGATGTTCAAGGACTCGCAAGTCCGGACTGGTTACTT
GATCGTCGGCATGATCAAAACCAAAACGCTGAACAACGCACTGCTGAGCATTTCGAAAGAATTTGGCAAA
ATCAACGCCGATACGTTGATCGACAAGTTTGCTGAAGTGGTGGCAGGCTCGCCCGAAGATTCGCTCCGCG
CCAGCGATGGAACCCAGGTCGGTGGCGGCGCTGTTCCTGGCGAAGCGAGCGGCGCGATGGCTCCCGCTGC
GATGGGCAAGCAAGAGGCGCTCAAGCAATTTTCGATCGACCTGACCGAGCGTGCTCGCAAAGGGGAGATC
GACCCGATTGTTGGTCGCGACGAAGAGATTCGTCAACTTGTCGACATTCTGATGCGTCGTCGTCAGAACA
ACCCAATCCTCACCGGTGAAGCAGGTGTGGGTAAAACTGCGGTGGTCGAAGGTTTTGCCCTCCGCATTGC
TTCGGGCGATGTTCCTCCGTCGCTGAAAGATGTTTCGCTTCGCTCGCTCGACATCGGTCTCTTGCAGGCC
GGCGCGAGCATGAAGGGCGAGTTCGAAAATCGCCTTCGTCAGGTGATCGAAGAAGTGCAATCGAGCGAAC
AGCCGATCATTCTGTTTATCGATGAAGCTCATACTCTCATCGGAGCTGGTGGAGCCGCTGGAACTGGCGA
CGCTGCTAACTTGCTCAAGCCAGCACTGGCTCGCGGAAAGTTGCGCACGGTCGCTGCGACGACCTGGGCC
GAATACAAGAAGCACATCGAAAAAGATCCTGCTCTCACGCGCCGCTTCCAAGTGGTTCAAGTCGGTGAAC
CAAGCGAAGACAAAGCGATTTTGATGATGCGAGGCATGGCCTCGACCCTCGAGCAGCACCATCGCGTGCA
GATTCTCGACGAAGCGCTCGAAGCCTCGGTTCGTCTCTCGCATCGCTATATCCCCGCTCGTCAGTTGCCC
GATAAGTCGGTCAGCTTGCTCGATACCACGTGTGCTCGCGTGGCGATCAGTCAGCACGCTGTGCCTGCAG
AAGTCGAAGATTGCCGCCGCAAGATCGAAGCTCTCGAAGTCGAGCAGGGAATCATCGCCCGCGAAAAAGC
TGTCGGTGTAGATACCACCAAACGCGAAAAAGAAGTCGATTCAAAACTAGCCATCGAGCGTGAGCGTCTG
AAGGGGCTTGAGCAGCGCTGGACCGACGAAAAGACGCTGGTCGACGAGATTCTCGACATTCGCGGCAAGC
TCCGCGGTCAAACGGGCAAGGTCGAGGGGACGCATAGCAAACTCGAAAAAGCTGCTGACAAGGCTGCCAA
AGAAGCACCACCTGTAGCGGCTCCTACGCCTCCGCTCACCGAAGCCGAACGGGCTCCGCTGCTGGCAAAA
CTCACCGAACTGCAAGCCAAGCTCACCGCCCTGCAAGGCGAATCGCCACTGATTCTTCCCACGGTCGACG
AGCAAGCGGTCGCTTCGGTCGTGGCCGACTGGACCGGCATTCCGGTCGGTCGAATGGTGAAGAACGAAGT
CGAAGCTGTGCTCAAGTTGGCCGAGACCCTCGGTCAGCGCGTGATTGGCCAAGACCATGCGATGAAGATG
ATTGCTCGCCGCATTCAAACTTCGCGTGCCCAGCTCGAGAATCCAAACAAGCCAATCGGCGTATTCTTGC
TCGCCGGCACGTCGGGTGTTGGTAAAACCGAAACCGCTCTCGCTTTGGCCGAAGCTCTTTATGGTGGCGA
ACAGAACGTCATCACCATCAACATGAGCGAGTTCCAAGAGGCTCATACCGTGAGCACCTTGAAGGGTTCG
CCTCCCGGTTACGTGGGCTACGGCGAAGGTGGTATTCTCACCGAAGCCGTCCGCCGCAAACCTTACAGCG
TGGTGCTCCTCGACGAAGTCGAAAAGGCTCACGGCGACGTGCACGAACTCTTCTTCCAAGTCTTCGATAA
AGGCTGGATGGAAGATGGCGAAGGACGCGTGATCGATTTCAAGAACACGCTCATCCTGCTGACGTCGAAT
GCCGGTAGCGACTTGATCATGAACATGTGCAAAGATCCGGAACTGCTTCCCGATCCTGAGGCCATTGCCA
AGTCGCTGCGCGATCCGCTGCTGAAGGTCTTTCCCGCAGCATTGCTCGGCCGCCTCGTGACCATTCCTTA
CTATCCGCTCAGCGATTCGATGATCGCTGCGATCACTCGTTTGCAGCTGCGTCGCATCGAGAAGCGAATC
GGCGTCAATCACAAGGTTCCGTTCACCTACAGCGACGAAGTGCTCAAGCTCATCGTCAGCCGCTGCACGG
AACTCGAGAGCGGTGGTCGTATGATCGACTCGATTCTCACCAACACAATGCTCCCCGCGATCAGCGAAGA
GATTCTCAAGCGGATGATGGTGGGTAGCGCGGTGAAGAAAATCGAAATCACCGCGAAAGGTAGCGAATTC
CACTACAACTTTGATTAG