SecReT6
Protein ID: 283786430
SecReT6 ID374
T6SS typei3
Gene symbolcts1D
Locus tagROD_27641
StrainCitrobacter rodentium ICC168
Repliconchromosome [GenBank: NC_013716] [Browse all T6SS(s) in this replicon]
Location [Strand]2914927..2915430 [-]
ProductT6SS lysozyme-related protein Cts1D
NoteTssE
UniProt IDD2THS6
KEGG IDcro:ROD_27641
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 1.60E-16, Aligned region: 40..147
Protein Sequence: 167 a.a.     [Download]
>gi|283786430|ref|YP_003366295.1| cts1D gene product [Citrobacter rodentium ICC168]
MSSNKSLNRGGRYLPALLERLQDDEPKSLHDRARPVDVKTIRQLVQKDITDLINHTNIEDTINEQRYKAV
TESVLNYGIPALIGSHENRNNWQLIEQAIRKAIIRFEPRIIPETLLVRSLQKKEQMAKYAVIAFEIRGLI
NWQPHPVDLCMNGRYDVESEKVELKLL
 
Nucleotide Sequence: 504 bp     [Download]
>gi|283783779|ref|NC_013716.1|:c2915430-2914927 Citrobacter rodentium ICC168, complete genome
TTGTCTTCAAATAAGTCGTTAAACAGAGGAGGCCGCTATCTGCCTGCTCTTCTGGAGCGGCTACAGGATG
ACGAACCTAAAAGCCTTCACGATCGCGCCCGGCCTGTCGACGTTAAAACGATACGTCAGCTGGTTCAGAA
AGATATTACTGATTTAATTAATCATACCAACATCGAGGACACGATCAATGAGCAACGCTATAAAGCAGTG
ACAGAATCCGTGCTTAATTATGGTATTCCGGCGTTGATCGGCAGCCATGAAAATCGTAATAACTGGCAGC
TTATCGAGCAGGCTATCCGTAAGGCTATCATTCGCTTCGAACCACGTATTATCCCTGAAACATTGCTGGT
GCGTTCATTGCAGAAAAAGGAGCAGATGGCGAAATATGCCGTTATTGCGTTTGAGATTCGGGGGCTAATT
AACTGGCAGCCCCACCCTGTAGATTTGTGTATGAATGGTCGTTACGACGTGGAGTCTGAAAAGGTAGAGC
TGAAGCTTCTTTAA