SecReT6
Protein ID: 283786431
SecReT6 ID374
T6SS typei3
Gene symbolcts1E
Locus tagROD_27651
StrainCitrobacter rodentium ICC168
Repliconchromosome [GenBank: NC_013716] [Browse all T6SS(s) in this replicon]
Location [Strand]2915417..2916214 [-]
ProductImpE family T6SS protein Cts1E
NoteTagJ
UniProt IDD2THS7
KEGG IDcro:ROD_27651
PDB IDNA
Domain hit(s) vs Pfam ImpE [PF07024], Evalue: 2.70E-37, Aligned region: 66..86
ImpE [PF07024], Evalue: 2.70E-37, Aligned region: 146..264
Protein Sequence: 265 a.a.     [Download]
>gi|283786431|ref|YP_003366296.1| cts1E gene product [Citrobacter rodentium ICC168]
MQDITTLNETLKTASLKDLLAQVLTRVKSFPQDLKAREVLFKLYCVDGAWDSALLQLQTLSLLDEEMKKQ
CELYKNLVFSEMQRTQVLAGERLAATLQGDMPQWMVKLHEANGQYCQGNRELSDMTRSEAFELAPESRGK
SDTLGEFSWIADSDGRLGPVCEFICAGGYRWLPFSEVQQLRVSKPKDLLDLLWTQASVNVAGEKYFGFIP
ARYPITTDDEQNYKLGSKTEWSTLSDLLILGHGRKVLITDCCVHSIMEVGEIVFK
 
Nucleotide Sequence: 798 bp     [Download]
>gi|283783779|ref|NC_013716.1|:c2916214-2915417 Citrobacter rodentium ICC168, complete genome
ATGCAGGATATTACGACATTAAATGAGACATTAAAAACCGCTTCTCTGAAAGACTTGCTGGCGCAGGTTC
TTACCCGGGTGAAGTCATTTCCGCAAGATCTTAAAGCCCGGGAAGTGCTGTTTAAATTGTATTGCGTTGA
CGGTGCATGGGATAGCGCGTTACTGCAATTGCAGACCTTATCGCTGCTTGACGAGGAAATGAAAAAACAG
TGTGAGCTATATAAAAACCTCGTCTTCAGTGAAATGCAGCGCACGCAGGTTTTAGCGGGCGAGCGTCTGG
CCGCAACGTTGCAGGGCGATATGCCGCAGTGGATGGTGAAACTACATGAGGCGAACGGACAATATTGCCA
GGGCAATAGGGAGTTATCGGATATGACGCGTTCTGAAGCATTTGAACTTGCGCCGGAAAGCCGTGGCAAA
AGTGATACTTTGGGCGAATTTTCCTGGATTGCAGACAGCGATGGCCGTCTTGGACCAGTGTGTGAATTTA
TTTGTGCCGGAGGATATCGTTGGCTACCTTTTTCTGAAGTTCAACAATTACGCGTTTCAAAACCGAAAGA
TCTCCTCGACCTTCTCTGGACGCAGGCATCCGTTAACGTTGCGGGGGAAAAATATTTTGGCTTCATTCCG
GCACGCTACCCGATTACGACGGATGATGAGCAAAATTATAAGCTGGGATCAAAGACAGAGTGGTCCACGC
TATCCGATCTGCTCATTCTCGGTCATGGCCGTAAGGTATTGATTACCGACTGCTGTGTACATTCGATCAT
GGAGGTGGGTGAGATTGTCTTCAAATAA