SecReT6
Protein ID: 283786432
SecReT6 ID374
T6SS typei3
Gene symbolcts1F
Locus tagROD_27661
StrainCitrobacter rodentium ICC168
Repliconchromosome [GenBank: NC_013716] [Browse all T6SS(s) in this replicon]
Location [Strand]2916232..2917095 [-]
ProductT6SS protein Cts1F
NoteFha
UniProt IDD2THS8
KEGG IDcro:ROD_27661
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 287 a.a.     [Download]
>gi|283786432|ref|YP_003366297.1| cts1F gene product [Citrobacter rodentium ICC168]
MSTSVNAMKFRFEWPVSRQPVTLQEGITAEWAIALAVSRGVFGPHSQLPEGQDAVAFYWHLTRPVMRNFC
VSAICLLDGVELCYGESQPLRVGSHLQIGHFKLEVTTEEADALTHQGVLPFIGAESARQAADNIPEVEEI
LPNGGSYINDLHYFNNVIAHRNSHDVLKVLEIEYKRFLIWQEQGRHYYDNVSNEAAYLIKTDNQFDRVKE
SLKEKTLTECIVDRPFLMEKVWPDFENSGVLDDIFVEEEKVDLLKSLSPEHIVAKGTYQVPELVFRDFHK
IGLDSHY
 
Nucleotide Sequence: 864 bp     [Download]
>gi|283783779|ref|NC_013716.1|:c2917095-2916232 Citrobacter rodentium ICC168, complete genome
ATGTCTACATCGGTTAACGCGATGAAGTTTCGTTTTGAATGGCCGGTATCGCGCCAGCCCGTGACGTTGC
AGGAAGGTATTACGGCGGAGTGGGCCATCGCGTTAGCGGTAAGTCGCGGGGTCTTTGGACCTCATAGCCA
GCTGCCGGAGGGGCAAGATGCGGTGGCTTTTTACTGGCATTTAACCCGTCCGGTCATGCGGAACTTTTGT
GTCAGCGCCATCTGTTTGCTGGACGGCGTGGAGCTCTGCTATGGCGAAAGCCAGCCCCTGCGCGTCGGTA
GTCATCTTCAGATCGGCCACTTTAAGCTGGAGGTGACCACTGAGGAGGCCGACGCGCTAACGCATCAGGG
GGTTTTGCCATTTATCGGTGCGGAGAGCGCCCGGCAGGCGGCGGATAACATCCCGGAAGTTGAGGAGATT
TTGCCGAACGGGGGCAGTTATATAAATGACCTGCATTATTTCAATAATGTCATCGCGCACAGGAATAGCC
ATGATGTTTTGAAAGTGCTTGAAATCGAGTACAAACGCTTTCTTATCTGGCAAGAGCAAGGACGTCATTA
CTACGATAACGTCAGCAATGAAGCGGCTTATCTTATCAAAACCGATAATCAATTTGACCGCGTAAAAGAA
AGCCTAAAAGAAAAGACCTTAACGGAATGTATTGTCGACAGACCTTTTCTGATGGAAAAGGTCTGGCCTG
ATTTTGAAAACAGCGGTGTCTTGGACGATATATTTGTCGAAGAAGAAAAAGTCGATTTACTTAAATCTCT
TTCACCGGAGCATATCGTGGCAAAAGGAACATATCAGGTTCCGGAACTGGTGTTCCGTGATTTCCACAAG
ATTGGCCTGGATTCACACTATTGA