SecReT6
Protein ID: 283786433
SecReT6 ID374
T6SS typei3
Gene symbolcts1G
Locus tagROD_27671
StrainCitrobacter rodentium ICC168
Repliconchromosome [GenBank: NC_013716] [Browse all T6SS(s) in this replicon]
Location [Strand]2917403..2919745 [-]
ProductVgrG family T6SS protein Cts1G
NoteTssI
UniProt IDD2THS9
KEGG IDcro:ROD_27671
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 7.20E-77, Aligned region: 29..346
Phage_base_V [PF04717], Evalue: 1.60E-26, Aligned region: 386..479
Protein Sequence: 780 a.a.     [Download]
>gi|283786433|ref|YP_003366298.1| cts1G gene product [Citrobacter rodentium ICC168]
MSRTITLSSPAMPLLLGDTALVISKLDGEEALSSLYSYVITAKTPANPLIPWQAASNVDLKALIGKEMTV
TIELDGNGLGDIFAIGKDTREISGIVQRARYIGRDSNQALYEIVIRPWLHLAELTTDFKIFQKKTVVDII
DEVLGDYNFPLEKRLAGSYPLLDFQVQYGESDFNFIERLMEEWGIYWFFEHAEQYHKLILVDNVGAHKRF
PSEAYHVVQYAADRPKMDQEYISQFHFQETITSGKWVTNDYDFTKSRADIMALDSKPRKTSFNEMEIFHW
PGDYEQPNIGEQLARVRMEERGALGSRCEGSGELRGIACGCDFELVNYPVEKANREYMILRSHLVVEEIN
QVTDVDEFRYHCDFTVQPTTKIYRHPMTVPRPKTSGPQTAIVVGPDGEEIWTDEYGRVKVRFLWDRYGKN
RESDSCWLRVSQAWAGNNFGGIYIPRIGHEVIVDFINGDPDRPLIIGSLYNNVTMPPWDLPVNATQSGLV
SRTVGGGRSNFNGIRFEDKPGLEQYWEQAERNMTRLTKQNEEQTIGMNSNVNVGLSRNLFVGANYMSDVV
GNSSAIIGGALAIQVGGGQTDNVALAKGINVGGAFMTTVGGYHSLAVGGASTTVAGGAMTLTAGGELVLS
AKKIKIVGSEQVIIQGGTVELNPGDCSDNCGGGGGGGGAMIGLPGLPAIPSLFGVVLPLPLLPTPTPAPT
TSTDTPTESPTETPTETPTETPTETPTETPTETPTETPTETPTETPTETPTETPTETPTETPTETPTETP
TETGNAIPEP
 
Nucleotide Sequence: 2343 bp     [Download]
>gi|283783779|ref|NC_013716.1|:c2919745-2917403 Citrobacter rodentium ICC168, complete genome
ATGTCACGTACTATTACATTAAGCAGTCCGGCGATGCCGTTATTGCTGGGCGATACCGCTCTGGTTATCT
CTAAGCTGGATGGCGAAGAGGCGCTGTCGTCCCTGTACTCCTATGTGATTACGGCTAAAACCCCGGCTAA
CCCTTTAATTCCCTGGCAGGCCGCATCGAATGTCGATTTAAAAGCATTAATCGGCAAAGAAATGACCGTC
ACCATTGAACTGGATGGTAACGGATTGGGGGATATTTTTGCCATTGGTAAAGATACCCGGGAAATATCAG
GAATTGTGCAACGTGCGCGTTATATCGGACGCGATAGTAATCAGGCGCTCTATGAAATTGTGATTCGCCC
ATGGCTGCATCTGGCAGAACTGACTACGGATTTTAAAATATTCCAGAAAAAAACCGTGGTGGATATTATT
GATGAGGTGTTAGGCGATTACAATTTCCCGTTAGAAAAAAGGCTGGCGGGAAGCTATCCGCTGCTGGATT
TCCAGGTTCAGTATGGTGAAAGCGACTTTAATTTTATTGAACGGTTAATGGAAGAGTGGGGGATTTATTG
GTTCTTTGAACATGCCGAACAGTACCACAAACTGATTCTGGTGGATAACGTCGGGGCGCATAAACGTTTC
CCGAGTGAAGCTTATCATGTGGTTCAGTACGCAGCCGATCGTCCGAAGATGGACCAGGAATATATCAGCC
AGTTTCATTTTCAGGAAACCATTACCTCCGGGAAATGGGTCACCAATGATTATGATTTTACGAAATCACG
TGCCGATATTATGGCGCTGGACAGCAAGCCGCGTAAAACCAGTTTTAACGAGATGGAGATCTTCCACTGG
CCAGGCGATTACGAGCAGCCCAATATCGGTGAGCAGCTGGCGCGGGTACGAATGGAAGAACGCGGGGCGC
TGGGGTCACGCTGCGAAGGTTCCGGTGAACTGCGCGGAATTGCCTGCGGGTGCGATTTTGAACTGGTGAA
TTACCCCGTCGAGAAAGCGAACCGCGAATACATGATTTTGCGAAGCCATCTGGTGGTGGAAGAGATTAAT
CAGGTGACCGACGTGGACGAATTCCGTTATCACTGCGATTTTACCGTTCAGCCAACCACCAAGATTTATC
GCCACCCGATGACGGTGCCCAGGCCGAAAACCAGCGGACCGCAAACGGCTATCGTTGTGGGTCCTGATGG
CGAAGAGATCTGGACCGACGAATATGGCCGCGTAAAGGTACGTTTTTTGTGGGATCGCTACGGTAAAAAC
CGGGAGTCCGACTCCTGCTGGCTACGTGTGAGCCAGGCCTGGGCCGGAAATAACTTTGGCGGGATCTATA
TTCCCCGTATCGGCCATGAAGTGATTGTCGACTTTATTAACGGCGATCCTGACCGACCGCTGATTATCGG
CAGCCTGTACAACAACGTAACGATGCCGCCGTGGGATCTGCCGGTGAACGCTACGCAGAGCGGGCTGGTT
AGCCGCACCGTTGGCGGTGGGCGCAGCAACTTTAACGGCATTCGCTTTGAAGATAAGCCCGGGCTTGAGC
AGTACTGGGAACAGGCCGAGCGCAATATGACTCGTTTAACCAAGCAAAACGAGGAGCAGACCATCGGCAT
GAATTCCAACGTGAATGTCGGTCTGTCACGAAATCTGTTCGTTGGCGCGAACTATATGTCGGATGTGGTC
GGCAACAGTAGCGCCATCATCGGCGGCGCGCTGGCCATTCAGGTGGGCGGAGGCCAGACCGATAACGTTG
CGCTGGCAAAGGGAATTAACGTCGGCGGCGCGTTTATGACGACCGTTGGCGGCTATCACTCGCTGGCTGT
CGGCGGCGCAAGCACCACCGTTGCGGGAGGGGCGATGACGCTCACTGCAGGCGGTGAACTGGTGCTCTCG
GCGAAGAAGATCAAAATCGTCGGTTCCGAACAGGTCATTATTCAGGGCGGCACGGTCGAGCTTAACCCTG
GCGACTGCAGCGATAACTGCGGCGGCGGCGGTGGGGGCGGTGGCGCAATGATTGGCCTGCCGGGCCTGCC
TGCGATTCCATCGCTGTTTGGCGTTGTGCTTCCGTTACCGCTGCTTCCGACGCCAACGCCTGCGCCTACG
ACATCAACGGACACGCCAACGGAATCCCCGACGGAGACGCCAACAGAAACCCCAACGGAGACGCCAACGG
AAACCCCGACGGAGACGCCAACGGAAACCCCGACGGAGACGCCAACGGAAACCCCGACGGAGACGCCAAC
GGAAACTCCGACGGAGACGCCAACGGAAACCCCGACGGAAACCCCAACAGAGACACCAACGGAAACCCCG
ACGGAGACAGGCAACGCAATTCCTGAACCTTAA