SecReT6
Protein ID: 283786435
SecReT6 ID374
T6SS typei3
Gene symbolcts1U
Locus tagROD_27711
StrainCitrobacter rodentium ICC168
Repliconchromosome [GenBank: NC_013716] [Browse all T6SS(s) in this replicon]
Location [Strand]2924258..2925613 [-]
ProductT6SS protein Cts1U
NoteTssL
UniProt IDD2THT1
KEGG IDcro:ROD_27711
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 1.30E-53, Aligned region: 78..284
OmpA [PF00691], Evalue: 6.40E-18, Aligned region: 345..443
Protein Sequence: 451 a.a.     [Download]
>gi|283786435|ref|YP_003366300.1| cts1U gene product [Citrobacter rodentium ICC168]
MKDDLNLQLSAEPAEDEGSSPQALGRFLLDEQGEWIQEPEATSKEETGPVGEHTARGEHALKSESVQQRI
LRVKAAENPLLEAAQPLLRALGDMPEQINDITHVEILKNTLKSQITLFGVVCDEVNIPWKKMAIVRYCLC
TALDEAAHTTAWGLEAGWSQSNLLNHFEGDNDGGNKFFLLVGRLSMNPTEFADVLEVLLRILGLGFEGRY
SIIEDGDRQLSKIRQRLLTLIQSTRNTTPPALSPHGLQPHGPAAREKLAIPVRLSALCAGVLVVSSFLWC
KFWLLSRSDGITNDIYAMQNFSVPVVQPAMRLKLAVLLRNEIRQQLLSVDENQKQSKVVLKGDALFLSGS
VRVQPEMVKVIERIASEVQRVNGDVLIVGHTDATPISRPGLPNNVALSEKRAAEVAQYFIAAGLPESKVK
VRGVGSSQPVANEATAQGRAKNRRVEFFVTY
 
Nucleotide Sequence: 1356 bp     [Download]
>gi|283783779|ref|NC_013716.1|:c2925613-2924258 Citrobacter rodentium ICC168, complete genome
ATGAAAGACGATCTTAACCTGCAACTCTCCGCGGAACCGGCGGAGGATGAGGGGAGTTCGCCGCAGGCGT
TGGGTAGGTTCCTGCTGGATGAACAGGGGGAGTGGATACAGGAGCCGGAAGCGACGTCGAAAGAGGAAAC
CGGGCCTGTTGGCGAGCATACGGCGCGTGGTGAACACGCACTGAAAAGCGAAAGCGTGCAGCAGCGGATC
TTACGCGTGAAGGCGGCGGAAAATCCGCTGCTGGAAGCCGCGCAACCGCTACTGCGCGCGCTTGGCGATA
TGCCGGAGCAGATTAACGATATTACCCATGTCGAAATCCTCAAAAACACCCTCAAAAGTCAGATCACGCT
GTTCGGCGTTGTCTGTGACGAGGTGAATATTCCGTGGAAAAAGATGGCGATCGTGCGTTATTGCCTCTGT
ACCGCGCTTGATGAGGCGGCGCATACCACGGCATGGGGGCTTGAAGCGGGCTGGTCGCAGAGTAACCTGC
TGAACCACTTTGAAGGAGATAACGACGGAGGGAATAAATTCTTTCTGCTGGTTGGCCGTCTCTCCATGAA
TCCCACTGAATTCGCGGATGTGCTGGAGGTGTTGCTGCGCATTCTGGGGCTGGGGTTTGAAGGGCGTTAC
AGCATTATTGAAGATGGCGACCGCCAGCTCAGCAAAATTCGCCAGCGTCTGTTGACCCTGATCCAAAGCA
CGCGAAACACCACGCCGCCCGCGCTGTCGCCGCATGGGCTGCAACCGCATGGACCTGCGGCGCGCGAGAA
GCTGGCGATCCCCGTGCGGCTAAGCGCGCTGTGCGCTGGCGTACTGGTGGTGTCGTCGTTTCTCTGGTGC
AAATTCTGGTTACTGTCGCGCAGTGACGGCATCACTAATGACATCTATGCCATGCAAAACTTCAGCGTGC
CCGTGGTGCAACCTGCCATGCGTCTGAAGCTGGCGGTGCTGCTGCGTAACGAAATCAGGCAGCAGCTTCT
CAGCGTGGATGAGAACCAGAAGCAGAGCAAAGTGGTGCTGAAAGGGGATGCGTTGTTCCTGTCCGGCTCT
GTCCGCGTTCAGCCGGAGATGGTGAAAGTTATTGAACGTATCGCCAGCGAAGTCCAACGCGTGAACGGCG
ACGTATTGATTGTCGGCCATACGGACGCCACCCCGATCAGTCGGCCAGGCCTGCCCAATAACGTTGCGCT
GTCGGAAAAACGCGCGGCGGAAGTGGCGCAATATTTTATTGCGGCCGGGCTGCCGGAGAGCAAAGTGAAA
GTCCGTGGCGTGGGGAGTAGTCAACCCGTGGCGAACGAAGCGACGGCTCAGGGAAGGGCGAAGAATCGCC
GTGTCGAGTTTTTTGTCACGTATTAA