SecReT6
Protein ID: 283786436
SecReT6 ID374
T6SS typei3
Gene symbolcts1M
Locus tagROD_27721
StrainCitrobacter rodentium ICC168
Repliconchromosome [GenBank: NC_013716] [Browse all T6SS(s) in this replicon]
Location [Strand]2925613..2926959 [-]
ProductT6SS protein Cts1M
NoteTssK
UniProt IDD2THT2
KEGG IDcro:ROD_27721
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 6.00E-141, Aligned region: 19..447
Protein Sequence: 448 a.a.     [Download]
>gi|283786436|ref|YP_003366301.1| cts1M gene product [Citrobacter rodentium ICC168]
MRTNKVVWSEGLFLRPQLFQQQERYFEYYAHKRASTLSPFFWGFSQYEIDREALSYGKLVLRAARGVLPD
GTPFDVPDHADLPEPLTILPEHLGKTIYLAVPLRLDNSDETIFSQHDVSSLARFRAQETELCDTNAIRQG
PKPVQLAKLRLRLMSQTEMTESWIGLPLTRVKAIQPDGSVLLHLDDYIPPVTGYAANPLLSEWLTHLNGL
VKMRAGMLAHRLSASDGKASASSEVADYLLLQIFNKYEPILDHLRHIPELPPIMLYEELAKLAGELSTFV
RTKTRRPRSAPGYDHASLYPSIRPLVDDVHDLLNQILVRAGQLIDLQAKGNGVWAASMLPNELCSFSNLV
LAVHAQLPMDVLLQQFQAQAKISAPQQLHELVRSHLPGLALQGLPVPPRQIPYSTGYVYFELLKKGPFWD
KISGIGALALHIAGEFPGLKMELWGIRN
 
Nucleotide Sequence: 1347 bp     [Download]
>gi|283783779|ref|NC_013716.1|:c2926959-2925613 Citrobacter rodentium ICC168, complete genome
GTGAGAACGAATAAAGTCGTCTGGAGTGAAGGGCTGTTTCTTCGTCCGCAGCTTTTTCAACAGCAAGAAC
GCTATTTTGAATACTACGCACATAAAAGAGCATCGACCCTGAGCCCCTTTTTTTGGGGATTCTCGCAGTA
TGAAATCGACCGCGAGGCGCTGTCGTATGGCAAGCTGGTGCTGCGTGCCGCGCGCGGCGTATTGCCGGAC
GGTACGCCGTTTGATGTGCCCGATCACGCCGATTTACCCGAGCCGCTAACGATTTTGCCGGAACATCTGG
GCAAGACGATTTATCTGGCGGTACCGTTACGCCTTGATAATAGCGATGAAACTATCTTCAGCCAGCATGA
CGTCAGTTCGCTGGCGCGTTTTCGCGCGCAGGAGACGGAACTGTGCGACACCAACGCGATTCGCCAGGGG
CCGAAGCCGGTTCAACTGGCCAAACTGCGGCTCAGGCTGATGTCGCAAACGGAAATGACCGAATCGTGGA
TTGGCCTGCCGCTGACCCGCGTCAAGGCGATTCAGCCTGATGGCAGCGTGCTGTTGCATCTGGACGATTA
TATCCCGCCCGTCACCGGCTATGCGGCGAATCCGCTGCTGAGCGAATGGCTTACCCATCTTAATGGCCTG
GTCAAAATGCGTGCCGGGATGCTGGCGCACCGCCTGTCGGCGTCCGACGGCAAGGCCAGCGCCAGCTCGG
AGGTGGCGGATTATCTGCTGTTGCAGATTTTCAATAAATACGAGCCGATTCTCGATCACCTGCGCCATAT
TCCGGAACTCCCGCCTATCATGCTTTACGAAGAGCTGGCGAAGCTGGCCGGTGAGCTTTCGACTTTTGTG
CGCACCAAAACGCGTCGTCCCAGGAGCGCGCCGGGCTATGACCACGCCAGCCTTTATCCTTCCATTCGTC
CCCTGGTCGACGATGTGCATGACCTGCTTAACCAGATCCTGGTGCGGGCCGGGCAGCTTATTGACCTGCA
GGCCAAAGGCAACGGCGTCTGGGCTGCCTCGATGCTGCCGAACGAACTGTGTTCGTTCTCAAACCTGGTG
CTGGCGGTTCATGCGCAGCTGCCGATGGATGTGTTGCTGCAGCAATTCCAGGCGCAGGCCAAAATCAGCG
CGCCGCAACAGCTCCATGAACTGGTTCGATCGCACCTGCCGGGCCTGGCGCTGCAAGGGCTGCCGGTACC
GCCGCGTCAGATCCCGTACAGCACGGGTTACGTCTATTTTGAACTGCTCAAAAAGGGGCCTTTCTGGGAC
AAGATTTCAGGCATCGGCGCGCTGGCGCTGCATATTGCGGGTGAGTTCCCTGGCCTGAAGATGGAACTTT
GGGGAATCAGGAACTGA