SecReT6
Protein ID: 283786437
SecReT6 ID374
T6SS typei3
Gene symbolcts1N
Locus tagROD_27731
StrainCitrobacter rodentium ICC168
Repliconchromosome [GenBank: NC_013716] [Browse all T6SS(s) in this replicon]
Location [Strand]2926963..2927490 [-]
ProductT6SS protein Cts1N
NoteTssJ
UniProt IDD2THT3
KEGG IDcro:ROD_27731
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 1.00E-26, Aligned region: 21..162
Protein Sequence: 175 a.a.     [Download]
>gi|283786437|ref|YP_003366302.1| cts1N gene product [Citrobacter rodentium ICC168]
MLSGKEIKRVLKRTTVFLLSLFLVACSGSSRPASDGDAIKINLLAASDINPNEMGEPAPLNIFIYNVKDL
DALTNADFYEIVEGTSKRVQAAASKVYEAILQPGESRTILIKPDGSTRSLAFIGAYRSLNYSLWLASWDL
PVKKKSWWRPGFFSDDSLELNARFQKTAITIKVMD
 
Nucleotide Sequence: 528 bp     [Download]
>gi|283783779|ref|NC_013716.1|:c2927490-2926963 Citrobacter rodentium ICC168, complete genome
ATGCTTAGCGGAAAAGAAATAAAACGCGTACTTAAGAGAACAACCGTTTTTTTACTGTCACTCTTTTTAG
TCGCCTGTAGTGGAAGCAGCCGTCCGGCGAGCGATGGCGATGCAATAAAAATAAATCTGCTGGCGGCAAG
CGATATTAACCCAAATGAAATGGGCGAACCGGCGCCACTCAATATATTTATTTATAACGTCAAGGATCTG
GATGCTTTAACCAATGCGGACTTTTATGAAATTGTTGAGGGGACCAGTAAACGTGTACAGGCGGCAGCGT
CAAAAGTCTATGAAGCGATTTTACAACCCGGAGAGTCGCGCACCATTCTGATTAAACCAGACGGTTCTAC
ACGCAGTCTTGCTTTCATTGGCGCCTATCGCAGCCTTAATTATTCTCTCTGGCTGGCGAGTTGGGATTTG
CCCGTAAAGAAAAAATCGTGGTGGCGACCGGGTTTCTTTAGCGATGATTCGCTTGAGCTGAATGCGCGTT
TCCAGAAAACAGCAATAACAATTAAAGTAATGGATTAA