SecReT6
Protein ID: 283786438
SecReT6 ID374
T6SS typei3
Gene symbolcts1H
Locus tagROD_27741
StrainCitrobacter rodentium ICC168
Repliconchromosome [GenBank: NC_013716] [Browse all T6SS(s) in this replicon]
Location [Strand]2927581..2928066 [-]
ProductHcp family T6SS protein Cts1H
NoteTssD
UniProt IDD2THT4
KEGG IDcro:ROD_27741
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 2.50E-41, Aligned region: 6..136
Protein Sequence: 161 a.a.     [Download]
>gi|283786438|ref|YP_003366303.1| cts1H gene product [Citrobacter rodentium ICC168]
MAQDMFIKIDGIEGESLDASHKNEIEVLSWRWASAQSSNMHSGSGGGAGKATVEDFCFEHYVDKASTNLL
SYCLSGKHIKDIQFVVRKAGGDPLEYLTIKFSDVIITRVETAGSNEDETRPRERVTFAFTKLTQDYVMQN
AEGAKSGVISTSYDVKANLRS
 
Nucleotide Sequence: 486 bp     [Download]
>gi|283783779|ref|NC_013716.1|:c2928066-2927581 Citrobacter rodentium ICC168, complete genome
ATGGCTCAGGATATGTTTATTAAAATTGATGGCATCGAAGGCGAATCTCTTGATGCTTCCCATAAAAATG
AAATCGAAGTGCTGTCCTGGCGTTGGGCCAGCGCGCAGAGTTCAAATATGCACAGCGGTTCCGGCGGCGG
CGCAGGTAAAGCAACGGTTGAAGATTTTTGCTTCGAGCACTATGTCGATAAGGCCAGTACGAATCTTCTG
AGCTACTGCCTGTCCGGTAAGCATATTAAAGACATTCAGTTTGTGGTTCGTAAAGCTGGCGGCGATCCGC
TGGAATATCTGACCATTAAATTCTCCGATGTCATTATTACCCGCGTTGAAACGGCAGGTTCCAACGAAGA
CGAAACACGCCCGCGTGAACGCGTGACGTTCGCCTTCACCAAACTGACCCAGGATTACGTTATGCAGAAC
GCCGAAGGCGCGAAATCTGGCGTAATTTCTACCAGTTATGACGTAAAAGCTAACCTGCGCAGCTAA