SecReT6
Protein ID: 283786439
SecReT6 ID374
T6SS typei3
Gene symbolcts1B
Locus tagROD_27751
StrainCitrobacter rodentium ICC168
Repliconchromosome [GenBank: NC_013716] [Browse all T6SS(s) in this replicon]
Location [Strand]2928226..2929725 [-]
ProductT6SS protein Cts1B
NoteTssC
UniProt IDD2THT5
KEGG IDcro:ROD_27751
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 8.00E-196, Aligned region: 67..493
Protein Sequence: 499 a.a.     [Download]
>gi|283786439|ref|YP_003366304.1| cts1B gene product [Citrobacter rodentium ICC168]
MATQAQNHKQAAPQATTQNDFNALLTREFKPKSEQAKSAVEMAVKTLAEQALSTSITMADDAYKNIAAII
AEIDLKLSEQINLILHHEEFQRLESAWRGLHYLVNNTETDEKLKLRFMDISKDDLRRNMKRYKGIAWDQS
PLFKQIYEEEYGQLGGEPYGCLVADYHFDHSAPDVDLLSSIGKVAASAHMPFITGASPSVMQMDSWQELA
NPRDLTKIFTQNLEYAAWNSLRQSEDSRYIGLAMPRFLARLPYGINTNPVDNFNFEEDTDGANHSKYVWA
NAAYAMAVNINRSFKHYGWCTMIRGVESGGVVEDLPCHTFPTDDGGVDMKCPTEIAISDRREAELAKNGF
IPLVHRKNTDYAAFIGAQSLQKPAEYYDPDATANANLSARLPYLFACSRFAHYLKCIVRDKIGSFKERED
MQRWLNNWVMNYVDGDPANSSQETKARRPLAAAEVVVEDVEGNPGYYQAKFFLRPHFQLEGLTVSLRMVA
KLPSLKDVA
 
Nucleotide Sequence: 1500 bp     [Download]
>gi|283783779|ref|NC_013716.1|:c2929725-2928226 Citrobacter rodentium ICC168, complete genome
ATGGCAACTCAAGCACAAAACCATAAGCAGGCCGCGCCGCAGGCCACCACGCAAAATGATTTTAATGCGT
TACTGACCCGTGAATTTAAGCCGAAATCCGAGCAGGCGAAATCGGCGGTCGAAATGGCGGTGAAAACCCT
GGCGGAACAGGCGCTCTCTACCTCGATCACTATGGCTGACGATGCTTATAAAAACATCGCGGCGATTATC
GCGGAGATTGACCTTAAGCTGTCAGAGCAAATTAACCTGATTCTTCATCATGAAGAGTTCCAGCGTCTGG
AAAGCGCCTGGCGCGGCCTGCACTACCTGGTGAACAACACCGAAACCGATGAGAAGCTGAAGCTGCGCTT
TATGGACATTTCCAAGGATGACCTGCGTCGCAACATGAAGCGCTACAAAGGGATCGCATGGGATCAAAGC
CCGCTATTTAAGCAGATTTACGAAGAAGAGTACGGTCAGCTTGGCGGCGAACCTTACGGCTGCCTGGTGG
CGGATTACCATTTCGATCACAGCGCGCCGGATGTGGATCTGCTCTCCTCGATTGGCAAGGTGGCGGCGTC
CGCCCATATGCCGTTTATTACCGGCGCGTCGCCATCCGTTATGCAGATGGACTCCTGGCAGGAGCTGGCT
AACCCGCGTGATCTGACGAAAATCTTTACCCAGAACCTGGAATATGCCGCGTGGAACTCCCTGCGTCAGT
CTGAGGACTCTCGTTATATCGGTCTGGCGATGCCGCGCTTCCTTGCGCGTCTGCCTTACGGCATCAACAC
TAACCCGGTAGATAACTTTAATTTTGAAGAAGATACCGACGGCGCGAATCACAGCAAATACGTCTGGGCT
AACGCTGCGTATGCGATGGCGGTCAACATCAACCGTTCCTTCAAGCATTACGGCTGGTGCACCATGATTC
GCGGCGTAGAGAGCGGCGGCGTGGTGGAAGATCTGCCTTGTCATACCTTCCCGACCGACGATGGCGGCGT
GGATATGAAATGCCCGACGGAAATCGCAATTTCCGATCGTCGCGAGGCGGAGCTGGCGAAGAATGGCTTT
ATTCCCCTGGTTCACCGTAAAAATACCGATTACGCGGCGTTTATTGGCGCGCAGTCATTGCAGAAACCAG
CGGAATATTACGATCCGGACGCCACGGCCAACGCCAATCTTTCCGCGCGTCTTCCGTACCTGTTTGCCTG
TTCACGTTTCGCACATTATCTGAAGTGCATCGTGCGCGACAAAATCGGTTCGTTCAAAGAGCGTGAAGAT
ATGCAGCGCTGGCTGAACAATTGGGTCATGAATTATGTCGATGGCGACCCGGCGAACTCATCGCAGGAAA
CCAAAGCGCGCCGTCCGCTGGCGGCGGCGGAAGTGGTGGTGGAAGACGTGGAAGGCAATCCGGGTTATTA
CCAGGCGAAATTCTTCCTGCGTCCTCATTTCCAACTGGAAGGTCTGACCGTTTCTTTACGCATGGTCGCT
AAATTACCGTCGCTGAAAGACGTGGCGTAA