SecReT6
Protein ID: 283786440
SecReT6 ID374
T6SS typei3
Gene symbolcts1S
Locus tagROD_27761
StrainCitrobacter rodentium ICC168
Repliconchromosome [GenBank: NC_013716] [Browse all T6SS(s) in this replicon]
Location [Strand]2929747..2930265 [-]
ProductT6SS protein Cts1S
NoteTssB
UniProt IDD2THT6
KEGG IDcro:ROD_27761
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 1.80E-61, Aligned region: 10..163
Protein Sequence: 172 a.a.     [Download]
>gi|283786440|ref|YP_003366305.1| cts1S gene product [Citrobacter rodentium ICC168]
MSKSNSQKFIARNRAPRVQIEYDVEIYGSEKKIELPFVMGVLADLSGKPLEPLPPVADRKFLSVDIDNFD
ERMKAMRPRVAFAVPNTLTGEGQLMVDMTFESMDDFSPDAIARKVDSLSQLLEARTQLANLQTYMDGKAG
AESLVMKVLNDKSLLNTLASAPKPERADEVAS
 
Nucleotide Sequence: 519 bp     [Download]
>gi|283783779|ref|NC_013716.1|:c2930265-2929747 Citrobacter rodentium ICC168, complete genome
ATGAGCAAGAGTAACTCACAAAAATTTATCGCACGTAATCGTGCGCCGCGCGTACAAATTGAGTACGACG
TAGAAATCTATGGCAGTGAAAAGAAAATTGAATTGCCGTTCGTGATGGGCGTGCTGGCGGATTTATCCGG
TAAACCGCTGGAGCCGCTGCCGCCTGTGGCAGACCGCAAATTCCTGAGTGTCGATATTGATAACTTTGAC
GAGCGTATGAAAGCCATGCGTCCGCGTGTCGCGTTCGCGGTGCCGAACACCTTAACGGGTGAAGGGCAAC
TGATGGTCGATATGACCTTCGAAAGCATGGATGATTTTTCTCCGGATGCGATTGCCCGCAAAGTTGACTC
GTTATCTCAGCTGCTTGAAGCCCGTACGCAGCTCGCCAATCTGCAGACCTATATGGACGGTAAAGCAGGC
GCGGAGAGCCTGGTGATGAAGGTACTGAATGACAAGTCGCTGTTGAACACCCTGGCATCGGCGCCAAAAC
CTGAACGGGCTGATGAAGTCGCGTCCTGA