SecReT6
Protein ID: 283786446
SecReT6 ID374
T6SS typei3
Gene symbolcts1C
Locus tagROD_27821
StrainCitrobacter rodentium ICC168
Repliconchromosome [GenBank: NC_013716] [Browse all T6SS(s) in this replicon]
Location [Strand]2937987..2939867 [+]
ProductT6SS protein Cts1C
NoteTssF
UniProt IDD2THU2
KEGG IDcro:ROD_27821
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 4.40E-199, Aligned region: 5..625
Protein Sequence: 626 a.a.     [Download]
>gi|283786446|ref|YP_003366311.1| cts1C gene product [Citrobacter rodentium ICC168]
MEHNFLDYYNQELTFVREMAREFAEQHPKIAGRLGMQGIETADPYVERLIEAFCFLSARTQIKLDAEFPK
FTQRLLDIIYPNYNAPTPSMGVVQLQPNLKEGDLTHGYVIPKKSTFYSRLLPGEMTRCEFRNNQDVRLWP
LDIAEVRLTSVPPDIPDLELHRLNHQQLKGALRIKLRLQGDLVFSDLNGLDELPIYIQGDERVVSHTFEL
LHGRHVAVVVRSGEGENIHHHVIVNDALKFEGLAPDQSLLPLQWNMFHGHTLIQEYIACRERFYFFSIAQ
LAAALEENNTNAVEIIILLNKLPQDLVPHLDASRFLLHCTAVINLFPKRVDRIEVNRALNNFHIVPDRSR
PMDYEVFSVDKVFGLQAETSEELTFNPLYQTRHSDTGNFGRYFSIRREVRVKEASHRKYDTRTPYSGTEI
FISLVDQQEAPYSEHIRYLLVDAMVTNRDLPRLLTSTGNLELTMSDSVPIHGARFVSSPSAPRSPFAVGE
AAWRLIRQLSFNYLPLSGMEHARGGESLRNMLRLFTSSADTETLTQINSLVGCKTEPVVRRLSEEGLLVY
GRGVRCSLTVDEEGFSGISPYLFGLVMENYLARHAAINIFTETELHSMQRGLIARWNARPGRRGAL
 
Nucleotide Sequence: 1881 bp     [Download]
>gi|283783779|ref|NC_013716.1|:2937987-2939867 Citrobacter rodentium ICC168, complete genome
GTGGAACACAACTTTCTAGATTATTATAACCAGGAACTGACGTTTGTCAGAGAAATGGCGCGAGAATTTG
CTGAGCAGCACCCGAAGATTGCCGGGCGACTAGGGATGCAGGGGATAGAAACTGCCGATCCTTACGTAGA
GCGTTTGATCGAGGCATTTTGCTTTTTATCTGCCCGAACGCAGATAAAACTCGATGCAGAATTTCCTAAA
TTCACCCAACGATTGCTGGATATTATCTACCCGAATTACAATGCGCCGACGCCGTCAATGGGGGTTGTTC
AACTACAGCCGAATCTGAAAGAAGGCGATTTAACGCACGGCTACGTCATCCCCAAAAAAAGCACTTTTTA
CAGTCGGTTACTGCCAGGCGAAATGACGCGTTGCGAATTCAGGAATAATCAGGACGTCAGGCTGTGGCCG
CTGGATATTGCAGAGGTGCGTTTAACCTCTGTCCCTCCGGATATTCCAGACCTGGAACTCCATCGCCTTA
ACCACCAGCAGTTAAAAGGCGCGCTGCGCATCAAGCTGCGTTTACAGGGTGATTTAGTATTCTCAGATTT
GAACGGACTGGATGAGCTACCCATTTATATTCAGGGTGATGAACGCGTAGTATCGCATACCTTTGAATTG
CTTCACGGCAGGCATGTCGCGGTGGTGGTTCGTAGCGGAGAGGGTGAAAATATTCACCATCACGTTATTG
TCAACGACGCGTTAAAATTTGAAGGGCTGGCGCCAGATCAGAGCCTGTTGCCCTTGCAATGGAATATGTT
CCACGGGCACACCCTGATACAGGAATATATCGCCTGCCGCGAGCGATTTTATTTTTTCTCGATCGCCCAG
CTGGCAGCCGCGCTGGAAGAGAATAATACCAATGCAGTAGAAATTATTATTCTGTTAAACAAATTACCGC
AGGATCTGGTGCCGCATCTGGACGCCTCGCGATTTTTACTGCACTGCACTGCGGTGATTAACCTCTTTCC
CAAACGCGTGGACCGAATTGAAGTTAACCGCGCGCTGAATAATTTTCATATCGTGCCGGACCGCAGCCGC
CCCATGGACTATGAAGTCTTTTCCGTCGATAAAGTCTTCGGCTTACAGGCGGAAACCAGCGAAGAGCTAA
CCTTTAATCCGCTCTACCAGACCCGACACAGCGACACCGGTAATTTTGGCCGTTATTTCTCCATCAGACG
GGAAGTCAGGGTGAAAGAGGCGAGCCACCGTAAATATGACACCCGCACGCCTTACAGCGGCACGGAGATT
TTTATTTCGCTGGTTGATCAACAGGAAGCGCCCTATAGCGAACATATTCGTTACCTGCTGGTTGACGCTA
TGGTAACCAACCGCGACCTGCCCCGCTTGCTGACCAGTACCGGCAACCTTGAGTTGACCATGTCAGACTC
CGTTCCGATTCACGGCGCCCGCTTCGTCAGCTCGCCAAGCGCCCCGCGTTCGCCATTCGCCGTTGGCGAG
GCGGCATGGCGGCTTATCCGTCAGCTTAGCTTTAACTATCTGCCTCTCTCCGGGATGGAACACGCCCGGG
GCGGCGAATCGCTGCGTAATATGCTGCGCCTGTTCACCAGCTCTGCCGATACGGAAACCCTGACGCAAAT
TAACAGCCTAGTGGGGTGTAAAACCGAGCCCGTGGTGCGTCGCCTGTCAGAGGAGGGACTGCTGGTTTAC
GGGCGCGGCGTGCGTTGTAGTTTAACCGTCGATGAAGAGGGTTTCTCCGGCATCAGTCCGTATCTTTTTG
GCCTGGTGATGGAAAATTACCTGGCGCGGCACGCGGCGATCAACATCTTTACCGAAACTGAACTGCACTC
CATGCAGCGCGGCTTAATCGCACGCTGGAACGCGCGTCCCGGCAGACGAGGCGCATTATGA