SecReT6
Protein ID: 283786447
SecReT6 ID374
T6SS typei3
Gene symbolcts1R
Locus tagROD_27831
StrainCitrobacter rodentium ICC168
Repliconchromosome [GenBank: NC_013716] [Browse all T6SS(s) in this replicon]
Location [Strand]2939864..2940895 [+]
ProductT6SS protein Cts1R
NoteTssG
UniProt IDD2THU3
KEGG IDcro:ROD_27831
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 5.20E-90, Aligned region: 12..310
Protein Sequence: 343 a.a.     [Download]
>gi|283786447|ref|YP_003366312.1| cts1R gene product [Citrobacter rodentium ICC168]
MKAVDAWFDDSKPWEAGFISTMRAIAARTPELPAPGKALLPSQERFRLGQVASMAFAPREIAAISQQDDK
IKLQLFSLGIWGAQGAMPLHLSELAYSRYEQHDHTLIDFVDIFHHRALSLFYRAWFLSQDTASLDRQEDE
RFSFYVGSLIGLDPAELSPDPLPVHTRLASSAHLIREARNPDGLLGAMRYYFGVPVRMEEFELQWITLEH
NDQTALGDSHCAGLLGNGAILGNTVLDRQHKFRLLMGPLTLAQYMLFSPWGSDMSVLRELVRSFIGFEYV
WDVQLVLAADQVPQARLDGAHQLGYASWLERNACDDPVFGMSFEPEMYHRELTSVPTAKRYVR
 
Nucleotide Sequence: 1032 bp     [Download]
>gi|283783779|ref|NC_013716.1|:2939864-2940895 Citrobacter rodentium ICC168, complete genome
ATGAAAGCGGTTGACGCCTGGTTTGATGACAGCAAGCCCTGGGAAGCGGGTTTTATTAGCACAATGCGCG
CGATTGCCGCCCGCACTCCTGAGCTACCGGCCCCCGGCAAAGCCCTGCTGCCCTCGCAGGAGCGTTTTCG
GCTGGGGCAAGTGGCCAGCATGGCCTTTGCGCCGCGTGAAATCGCCGCCATCAGCCAGCAGGATGACAAA
ATCAAGTTGCAGCTTTTTAGTTTGGGTATCTGGGGGGCGCAGGGCGCCATGCCGCTTCACCTTTCCGAAC
TGGCTTACTCCCGCTACGAGCAGCACGACCATACGCTGATTGATTTTGTCGATATTTTTCACCACCGCGC
GCTTAGCCTGTTTTATCGCGCGTGGTTTTTATCGCAGGATACCGCCTCGCTGGACAGACAGGAGGACGAG
CGGTTTTCGTTTTACGTCGGCAGCCTGATCGGCCTCGATCCAGCAGAACTCTCTCCCGATCCGTTACCTG
TCCACACCCGGCTGGCCTCTTCCGCCCACCTTATTCGCGAAGCCCGTAACCCGGACGGCCTGCTGGGGGC
GATGCGCTACTACTTTGGCGTGCCGGTTCGCATGGAAGAGTTTGAACTGCAATGGATAACCCTTGAGCAT
AACGATCAAACCGCGCTCGGCGACAGCCATTGCGCCGGGCTACTGGGAAACGGCGCGATCCTCGGCAACA
CCGTGCTGGACAGACAACATAAATTCAGGCTGCTCATGGGACCGCTGACGCTTGCCCAGTACATGCTGTT
CAGCCCGTGGGGCAGCGATATGTCAGTGCTGCGTGAACTGGTGCGCAGTTTTATCGGTTTTGAATATGTC
TGGGATGTGCAACTGGTACTGGCTGCCGATCAGGTGCCACAGGCCCGGCTTGATGGCGCCCACCAGCTTG
GTTACGCAAGCTGGCTGGAGCGTAATGCTTGTGATGACCCGGTTTTCGGCATGAGCTTCGAGCCGGAAAT
GTATCACCGCGAGTTAACGTCTGTACCCACAGCAAAAAGATACGTGCGATGA