SecReT6
Protein ID: 283786448
SecReT6 ID374
T6SS typei3
Gene symbolcts1A
Locus tagROD_27841
StrainCitrobacter rodentium ICC168
Repliconchromosome [GenBank: NC_013716] [Browse all T6SS(s) in this replicon]
Location [Strand]2940892..2941962 [+]
ProductT6SS protein Cts1A
NoteTssA
UniProt IDD2THU4
KEGG IDcro:ROD_27841
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 1.30E-19, Aligned region: 62..121
ImpA-rel_N [PF06812], Evalue: 1.30E-19, Aligned region: 131..149
Protein Sequence: 356 a.a.     [Download]
>gi|283786448|ref|YP_003366313.1| cts1A gene product [Citrobacter rodentium ICC168]
MNQTYPLTCSDYYQPLMSPISGSDACGETLDYDPAFIMLQSRLQPKLDAEYGNFIEAAEPINWAETEREC
QTLLQKSKDVRLIIILMRCRLRKVGLAALAEGLEALHALLCAWPDDLHPQLLDEGEFAPMLRANAFAELE
DANGLLADLRNHPLPKASGLQITIKEFEKAHQLPREEGALSDTAMAAIIHEWQLNARDSLFPLTQAYGFL
IEIKSVLAETLGHDAPEFAVLGNLLVYFANDFKGVSPSPVVLPSIVEDETPRVQEIAERPAGEVPAVLDL
PPVAPPAVVEPRRAIDSRADALHRLQEVRCWFAMTEPSSPLIQVLKYAEESIGKSFADLLKMYPPEIVAM
LNHEKE
 
Nucleotide Sequence: 1071 bp     [Download]
>gi|283783779|ref|NC_013716.1|:2940892-2941962 Citrobacter rodentium ICC168, complete genome
ATGAATCAAACATACCCTCTGACCTGTTCAGATTATTACCAGCCCCTGATGTCGCCCATCTCAGGCAGCG
ACGCCTGCGGCGAGACGCTCGATTACGACCCCGCATTCATCATGTTACAGTCCCGGCTCCAGCCCAAACT
GGACGCGGAATACGGCAACTTCATTGAAGCGGCGGAGCCCATTAACTGGGCTGAAACCGAGCGCGAATGC
CAGACCCTGCTGCAAAAAAGTAAAGACGTCCGGCTGATTATCATCCTGATGCGCTGTCGGCTACGTAAAG
TCGGCCTCGCCGCCCTGGCGGAAGGGCTGGAAGCGCTTCACGCCTTACTGTGTGCATGGCCGGACGATCT
GCATCCGCAGCTTCTTGATGAAGGGGAGTTTGCTCCGATGCTGCGCGCCAACGCCTTCGCCGAGCTGGAG
GATGCCAACGGCCTGCTTGCCGACCTGCGCAATCATCCGCTGCCGAAAGCCTCCGGCTTGCAAATCACCA
TCAAAGAGTTTGAAAAAGCGCATCAGCTTCCGCGAGAAGAGGGCGCGCTGTCGGATACGGCCATGGCCGC
CATTATTCATGAATGGCAGCTTAACGCCCGTGACAGTCTCTTCCCGCTTACCCAGGCGTACGGCTTCCTG
ATTGAGATAAAAAGCGTGCTTGCCGAAACGCTCGGGCACGATGCGCCAGAATTTGCCGTACTCGGTAACC
TGCTGGTCTATTTCGCTAATGATTTCAAAGGCGTATCCCCTTCCCCGGTCGTTTTGCCGTCTATCGTGGA
GGATGAAACGCCGCGGGTTCAGGAGATCGCGGAACGTCCCGCCGGAGAGGTCCCCGCTGTGCTGGATCTT
CCTCCCGTCGCGCCGCCTGCCGTCGTGGAACCGCGCCGCGCTATCGACAGCCGCGCCGATGCGCTGCACC
GCTTACAGGAAGTCCGCTGCTGGTTTGCGATGACCGAGCCCAGCAGCCCGCTTATTCAGGTGCTGAAGTA
CGCGGAAGAGAGCATCGGCAAAAGCTTTGCCGACCTCTTAAAAATGTATCCCCCTGAGATCGTCGCCATG
CTGAATCACGAGAAGGAATAA