SecReT6
Protein ID: 283787009
SecReT6 ID375
T6SS typei4a
Gene symbolcts2A
Locus tagROD_34111
StrainCitrobacter rodentium ICC168
Repliconchromosome [GenBank: NC_013716] [Browse all T6SS(s) in this replicon]
Location [Strand]3590954..3591874 [-]
ProductT6SS protein Cts2A
NoteTssA
UniProt IDD2TPU1
KEGG IDcro:ROD_34111
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 3.00E-13, Aligned region: 54..113
ImpA-rel_N [PF06812], Evalue: 3.00E-13, Aligned region: 175..195
Protein Sequence: 306 a.a.     [Download]
>gi|283787009|ref|YP_003366874.1| cts2A gene product [Citrobacter rodentium ICC168]
MEQIEALLAPIRADNPCGESMRYSPEFDRLVAARQQDDESLPTGVWQSTLRRADWDEVAHIARELTLNGS
KDLVIMGWLGEAWLRLRGLLALPDALALPVLALERYPEALHPQIKEGDYDYRAAPLSWLAQHYATLVAEA
PLFYSSEESVSLAEWQQGKTAGQISPEIQASIVQALAASLEWLQRLNAVCRHWPEDSAPSFSGLEQKIKT
CQQALGGTLPEPTPVVEQAVAPAPACSATFHSREEAYRMIKQVADYLQRTEPHSPVPYLLQRAFVWGNTP
LPELLNELISGDEAARQLWRQLGVLP
 
Nucleotide Sequence: 921 bp     [Download]
>gi|283783779|ref|NC_013716.1|:c3591874-3590954 Citrobacter rodentium ICC168, complete genome
ATGGAACAGATTGAAGCACTGCTGGCGCCCATTCGCGCCGATAACCCCTGCGGCGAATCGATGCGCTACT
CGCCGGAATTTGATCGGCTGGTCGCCGCCCGACAGCAGGACGATGAGTCGCTACCCACCGGCGTCTGGCA
GAGCACGCTCCGGCGAGCCGACTGGGATGAGGTCGCCCATATCGCCCGCGAGCTGACGCTTAACGGCAGT
AAGGATCTGGTCATTATGGGCTGGCTGGGTGAAGCGTGGCTCCGCCTGCGTGGTCTGCTTGCGCTGCCCG
ATGCGCTGGCGCTGCCGGTACTGGCGCTGGAGCGTTACCCGGAGGCGCTCCACCCACAGATTAAAGAAGG
CGATTACGACTATCGCGCCGCGCCGCTCAGTTGGCTGGCGCAGCACTACGCGACGCTGGTGGCTGAGGCC
CCGTTGTTTTACTCTTCAGAAGAGAGCGTGTCGTTGGCCGAGTGGCAGCAGGGTAAAACGGCCGGACAGA
TATCCCCGGAAATACAGGCATCGATCGTTCAGGCGCTGGCGGCAAGTCTGGAATGGCTACAGCGTTTGAA
CGCCGTCTGTCGACACTGGCCGGAGGATTCAGCGCCCTCCTTTAGCGGGCTGGAGCAAAAAATTAAGACC
TGTCAGCAGGCGCTGGGCGGCACCCTGCCTGAACCTACGCCAGTGGTTGAGCAGGCGGTTGCCCCAGCGC
CCGCCTGCAGCGCAACCTTTCACAGTCGCGAGGAGGCCTACCGGATGATTAAGCAGGTCGCTGACTATTT
GCAGCGCACCGAGCCGCACAGTCCGGTGCCCTATCTGTTGCAGCGCGCCTTCGTGTGGGGAAATACGCCG
CTGCCGGAGCTACTGAATGAACTGATTAGCGGCGATGAGGCCGCCCGCCAACTGTGGCGGCAACTGGGAG
TCTTACCATGA