SecReT6
Protein ID: 283787010
SecReT6 ID375
T6SS typei4a
Gene symbolcts2U
Locus tagROD_34141
StrainCitrobacter rodentium ICC168
Repliconchromosome [GenBank: NC_013716] [Browse all T6SS(s) in this replicon]
Location [Strand]3595417..3596163 [-]
ProductT6SS protein Cts2U
NoteTssL
UniProt IDD2TPU2
KEGG IDcro:ROD_34141
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 1.20E-21, Aligned region: 46..217
Protein Sequence: 248 a.a.     [Download]
>gi|283787010|ref|YP_003366875.1| cts2U gene product [Citrobacter rodentium ICC168]
MSVTPDMPACRLFDDLFSRWLAQFEQWKSAPLPPDELHRQAFDYSCQAVAEYSRRLSRELGAPFRAHIDA
AVYALVALIDETVLYGDWPALTFWQACPLEFHLWQTHCAGDRFPVCVQTLLDERNPASRDLAALYLRCLT
LGFGARRSDFNPLAHKETCRMLWHFAFQQDAEPGDIVTRLDASSLGSPLLLPPRRRLPDNSRLHLIAVVV
LLALLLLSQRLWLSIEDAIGVDTLPVFPVSTFCGGEKS
 
Nucleotide Sequence: 747 bp     [Download]
>gi|283783779|ref|NC_013716.1|:c3596163-3595417 Citrobacter rodentium ICC168, complete genome
ATGTCGGTCACGCCTGATATGCCCGCCTGCCGTCTGTTCGACGACCTATTTTCCCGCTGGCTGGCGCAGT
TCGAACAGTGGAAAAGTGCCCCTCTGCCCCCCGACGAACTGCATCGCCAGGCGTTTGATTACAGCTGTCA
GGCGGTAGCGGAATATAGTCGACGCCTGTCCCGGGAACTGGGCGCGCCGTTTCGCGCGCACATTGACGCC
GCGGTTTATGCGCTGGTGGCGCTGATTGACGAAACCGTTCTTTACGGCGACTGGCCCGCCCTGACGTTCT
GGCAGGCGTGCCCGCTGGAATTTCACCTGTGGCAGACCCACTGCGCGGGCGATCGTTTTCCGGTATGCGT
ACAGACTCTGCTCGACGAACGTAATCCGGCCAGCCGCGATCTGGCGGCGCTTTACCTGCGCTGCCTGACG
CTTGGCTTCGGCGCCAGACGCAGCGATTTTAATCCGCTGGCGCATAAGGAAACCTGCCGGATGCTCTGGC
ATTTCGCCTTCCAGCAGGATGCCGAGCCTGGCGACATCGTGACGCGTCTTGACGCCAGTTCGCTGGGGTC
GCCGCTGCTGCTTCCGCCCCGTCGACGTCTGCCGGACAACTCGCGCCTGCACCTGATCGCCGTCGTTGTG
CTGCTGGCGCTGCTGCTGTTAAGTCAACGTTTGTGGCTGAGTATTGAAGATGCCATTGGCGTCGACACGT
TACCGGTCTTCCCGGTCAGCACGTTCTGCGGAGGCGAAAAATCATGA