SecReT6
Protein ID: 283787011
SecReT6 ID375
T6SS typei4a
Gene symbolcts2M
Locus tagROD_34151
StrainCitrobacter rodentium ICC168
Repliconchromosome [GenBank: NC_013716] [Browse all T6SS(s) in this replicon]
Location [Strand]3596147..3597481 [-]
ProductT6SS protein Cts2M
NoteTssK
UniProt IDD2TPU3
KEGG IDcro:ROD_34151
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 7.60E-56, Aligned region: 20..407
Protein Sequence: 444 a.a.     [Download]
>gi|283787011|ref|YP_003366876.1| cts2M gene product [Citrobacter rodentium ICC168]
MNAIPEMVCWYEGMAMLPQHFQLQSLRNEALAAALAHSANPYFWGVKRMEVDNASLCAGTLRLLRLEAIM
PDGMPVDYDISRDPPLEFDCVSLLPALPDSAHTLYLAVPPANRAGIWQPMDGRYRSISSAPLPDLTSGEF
PESIPLWQPAPRLVSQHERADFVCLPLIQVVYTEGGFQQNDWFAPTPALDKNSYLIRHTRQLCLQAREKI
LFLSREMQLAQQNQQTTDWLSLALSLQSLQGALPLLECLLNSGKPHPVDLWRALCLFLGQTAILNEEKTL
PLLPGFDYQNMLPAFISLFSLLKAQLASIRRRLLRLNFSSEENHFALSLPKGLNAGDRVTIGVLMPNGCA
LPAETWLHQCLIASQPFLATLRRQRMHGMNIAPLATQQRGEWETDPAIALFTLTLTAQWFAKEMPLIVAP
LHKTDGAPERITLYCQENHDVGHA
 
Nucleotide Sequence: 1335 bp     [Download]
>gi|283783779|ref|NC_013716.1|:c3597481-3596147 Citrobacter rodentium ICC168, complete genome
ATGAACGCAATTCCCGAAATGGTCTGCTGGTATGAAGGAATGGCGATGCTGCCGCAGCATTTTCAACTGC
AGTCGCTGCGCAATGAGGCGCTCGCTGCGGCTCTTGCCCATAGCGCTAACCCCTACTTCTGGGGCGTTAA
GCGGATGGAAGTGGATAACGCGTCGCTGTGCGCAGGCACGCTGCGCCTTCTGCGTCTGGAGGCAATCATG
CCCGACGGCATGCCGGTGGATTATGACATCAGCCGCGATCCGCCGCTGGAATTCGACTGCGTCAGCCTGC
TGCCCGCGCTGCCCGACAGCGCGCACACTCTGTATCTGGCCGTGCCCCCGGCGAATCGCGCCGGGATCTG
GCAACCCATGGACGGTCGCTACCGATCCATTAGCAGCGCACCGCTGCCCGATCTCACCAGCGGCGAGTTC
CCTGAGAGCATTCCGCTCTGGCAGCCCGCGCCACGGCTGGTCAGCCAGCATGAACGCGCCGATTTCGTCT
GCCTGCCGCTGATACAGGTGGTTTATACCGAGGGGGGATTCCAGCAGAACGACTGGTTCGCTCCCACCCC
GGCGCTGGACAAAAATAGCTATCTTATCCGTCATACCCGCCAGCTCTGCCTGCAGGCGCGGGAAAAAATC
CTTTTTCTCAGTCGGGAGATGCAGCTGGCGCAGCAGAATCAGCAGACCACCGACTGGCTGAGCCTGGCCC
TGTCGCTGCAAAGCCTGCAGGGCGCTTTGCCGCTGCTGGAATGCCTGCTGAACAGCGGCAAGCCCCATCC
GGTGGATCTCTGGCGCGCCCTCTGTCTGTTCCTCGGCCAGACGGCGATTCTCAACGAAGAGAAAACGCTG
CCGCTGCTGCCGGGCTTTGACTACCAGAATATGCTGCCCGCTTTCATCTCGCTCTTTAGCCTGCTGAAAG
CACAGCTTGCCAGCATCCGACGCCGCCTGCTGCGGCTGAACTTCAGCAGCGAGGAGAATCACTTCGCCCT
GTCGCTGCCGAAAGGCCTTAACGCGGGCGATCGGGTCACCATCGGCGTGCTGATGCCGAACGGCTGCGCG
TTACCGGCGGAGACCTGGCTGCATCAGTGCCTGATCGCCAGCCAACCGTTTCTGGCGACGTTGCGGCGCC
AGCGGATGCACGGCATGAATATTGCGCCACTGGCGACACAACAGCGCGGCGAATGGGAAACCGACCCCGC
TATCGCCCTGTTCACGCTGACTCTCACTGCCCAGTGGTTTGCAAAAGAAATGCCGCTGATCGTTGCGCCG
CTGCATAAAACGGACGGCGCGCCGGAACGAATTACGCTTTACTGCCAAGAGAATCACGATGTCGGTCACG
CCTGA