SecReT6
Protein ID: 283787013
SecReT6 ID375
T6SS typei4a
Gene symbolcts2S
Locus tagROD_34171
StrainCitrobacter rodentium ICC168
Repliconchromosome [GenBank: NC_013716] [Browse all T6SS(s) in this replicon]
Location [Strand]3598320..3598832 [+]
ProductT6SS protein Cts2S
NoteTssB
UniProt IDD2TPU5
KEGG IDcro:ROD_34171
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 1.20E-53, Aligned region: 9..161
Protein Sequence: 170 a.a.     [Download]
>gi|283787013|ref|YP_003366878.1| cts2S gene product [Citrobacter rodentium ICC168]
MAESIQHKLNQIRPPRVQITYDVETGGAVEKKELPMVVGILADLSGQPASPPQKLRERRFVEIDRDNFDD
VLSSISPRLAIQVDNRLANDDSKLNVELNFRTFEDFTPLNIINQVKPLQRLFLARQRLRDLLTKLDGNDD
LDTLLQQVVNDNAELQALRPAEKNSTTENV
 
Nucleotide Sequence: 513 bp     [Download]
>gi|283783779|ref|NC_013716.1|:3598320-3598832 Citrobacter rodentium ICC168, complete genome
ATGGCCGAAAGCATTCAACATAAACTCAACCAAATAAGACCGCCGCGCGTTCAAATTACCTATGACGTGG
AAACCGGCGGGGCCGTTGAGAAAAAAGAACTGCCTATGGTGGTGGGGATTCTGGCCGATCTGTCCGGTCA
GCCAGCCTCCCCGCCGCAGAAACTTCGCGAACGTCGCTTCGTCGAAATCGACCGCGATAACTTTGATGAC
GTACTTTCCTCGATCTCCCCCCGCCTGGCGATTCAGGTGGATAACCGCCTGGCGAACGATGACAGCAAGC
TCAACGTTGAACTGAATTTCAGAACATTCGAAGACTTTACCCCTCTCAACATTATCAACCAGGTTAAGCC
GCTTCAGCGTCTTTTTCTTGCCCGCCAGCGCCTGCGCGATCTGTTGACCAAGCTGGACGGCAACGACGAT
CTGGACACGCTGCTGCAGCAGGTGGTCAATGACAATGCGGAGCTGCAGGCGCTGCGTCCGGCAGAGAAAA
ACTCTACGACGGAAAACGTTTAA