SecReT6
Protein ID: 283787014
SecReT6 ID375
T6SS typei4a
Gene symbolcts2B
Locus tagROD_34181
StrainCitrobacter rodentium ICC168
Repliconchromosome [GenBank: NC_013716] [Browse all T6SS(s) in this replicon]
Location [Strand]3598851..3600332 [+]
ProductT6SS protein Cts2B
NoteTssC
UniProt IDD2TPU6
KEGG IDcro:ROD_34181
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 3.90E-187, Aligned region: 66..488
Protein Sequence: 493 a.a.     [Download]
>gi|283787014|ref|YP_003366879.1| cts2B gene product [Citrobacter rodentium ICC168]
MENVQEQAETSGQTVTLSVLDRIIQEGRMARDELQQTYARDMLEELATQILDEGMAVENDTVAMINHRIA
QIDELISAQLNEVLHHPDMQRLEASWRGLHQFVMNTETSARLKLRLLNVSRKELQDDLEKAVEFDQSTLF
KKLYEEEYGTFGGNPYSVLVGDFEFGRHPQDVALLEKISQVAAAAHAPFIAAASPRLFDMGSFAELSVPR
DLAKIFESSELIKWRAFRESEDSRYVSLVLPHVLQRLPYGPDTLPVEGINFVEDVDGLDASKYLWGNAAW
ALANRITEAFTLYGWCAAIRGVEGGGLVQHLPAHTFSTPSGDISLRCPTEIAITDRREKELNDLGFIALC
HKKNTDTAAFFGGQTTNQAKIYNTPEANANARISAMLPYVFAASRFAHYLKVIMRDKVGSFLSRDEVESY
LNNWIADYVLLRDTAPQEIKARYPLREARIDVSEVPGKPGVYRAVVFLRPHFQLEELTTSIRLVAELPPP
AAA
 
Nucleotide Sequence: 1482 bp     [Download]
>gi|283783779|ref|NC_013716.1|:3598851-3600332 Citrobacter rodentium ICC168, complete genome
ATGGAAAATGTTCAGGAACAGGCTGAAACCAGCGGCCAGACGGTCACGCTGAGCGTGCTGGATCGCATTA
TTCAGGAAGGCCGCATGGCGCGGGATGAGCTTCAGCAAACCTACGCTCGCGACATGCTGGAAGAGCTGGC
TACGCAAATTCTCGATGAAGGCATGGCGGTGGAAAACGACACTGTCGCGATGATCAACCATCGCATCGCG
CAGATTGATGAACTGATTAGCGCCCAGCTTAACGAAGTGCTGCATCACCCCGACATGCAGAGGCTGGAGG
CCAGCTGGCGCGGCCTGCATCAGTTTGTGATGAATACCGAAACCAGCGCCCGCCTGAAGCTGCGCCTGCT
CAACGTCTCGCGTAAAGAGCTGCAGGACGATCTGGAAAAGGCGGTTGAATTTGACCAGAGCACGCTGTTT
AAAAAGCTGTATGAAGAGGAGTACGGCACTTTCGGCGGCAATCCGTACAGCGTCCTGGTTGGCGACTTTG
AGTTTGGCCGCCACCCGCAGGATGTGGCGCTGCTGGAAAAAATCTCGCAGGTTGCCGCCGCGGCCCACGC
GCCGTTTATCGCTGCCGCCAGCCCGCGCCTGTTCGACATGGGATCGTTTGCCGAGCTGAGCGTCCCGCGC
GATCTGGCGAAAATCTTCGAGAGCAGCGAGTTAATCAAATGGCGGGCCTTCCGCGAAAGCGAAGATTCAC
GCTACGTGTCGCTGGTGCTGCCGCACGTGCTGCAACGTTTGCCCTATGGGCCGGATACTCTGCCGGTGGA
AGGGATTAACTTTGTTGAAGACGTGGATGGACTGGATGCCAGCAAATACCTGTGGGGCAACGCCGCCTGG
GCGCTGGCTAACCGGATCACCGAAGCATTTACCCTCTATGGCTGGTGTGCGGCAATCCGCGGTGTGGAAG
GCGGCGGGCTGGTGCAGCATCTACCGGCTCACACTTTTTCCACCCCTTCCGGCGATATCAGCCTGCGCTG
CCCGACGGAGATCGCCATTACCGATCGTCGTGAGAAAGAGCTTAACGATCTCGGTTTTATCGCGCTGTGC
CACAAAAAGAACACCGATACGGCGGCCTTTTTTGGCGGGCAGACGACCAATCAGGCAAAAATCTACAACA
CGCCGGAAGCCAACGCCAACGCGCGTATTTCAGCGATGCTGCCCTATGTTTTCGCCGCTTCCCGCTTTGC
GCACTACCTGAAGGTGATCATGCGCGATAAGGTCGGCAGCTTTCTGAGTCGCGACGAGGTGGAAAGCTAT
CTTAATAACTGGATCGCTGACTACGTGCTGCTGCGTGATACCGCTCCTCAGGAGATCAAGGCGCGTTATC
CGCTACGTGAAGCGCGTATCGACGTGAGTGAAGTGCCCGGCAAACCTGGGGTTTACCGCGCCGTTGTGTT
CCTGCGCCCGCACTTCCAGCTCGAAGAACTCACTACTTCAATTCGCCTGGTCGCGGAACTGCCGCCGCCA
GCTGCGGCCTGA