SecReT6
Protein ID: 283787016
SecReT6 ID375
T6SS typei4a
Gene symbolctsD
Locus tagROD_34201
StrainCitrobacter rodentium ICC168
Repliconchromosome [GenBank: NC_013716] [Browse all T6SS(s) in this replicon]
Location [Strand]3600836..3601216 [+]
ProductT6SS protein Cts2D
NoteTssE
UniProt IDD2TPU8
KEGG IDcro:ROD_34201
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 2.90E-13, Aligned region: 20..113
Protein Sequence: 126 a.a.     [Download]
>gi|283787016|ref|YP_003366881.1| ctsD gene product [Citrobacter rodentium ICC168]
MKQPAIPVALFDRLVDENISPRESVRRELICLFNTRAPQQTEGLPPLLIWGAPEWHGLNVSDKRVLNGVC
RQLRSAILRLEPRIVALTVSVKEAGQQALALHIDAQLWHDDAPLQLELAWRNGSWQ
 
Nucleotide Sequence: 381 bp     [Download]
>gi|283783779|ref|NC_013716.1|:3600836-3601216 Citrobacter rodentium ICC168, complete genome
ATGAAGCAGCCCGCCATTCCGGTTGCGCTATTCGACAGACTGGTGGATGAGAATATTTCGCCGCGTGAAT
CGGTACGCCGTGAACTGATCTGCCTGTTTAATACCCGCGCCCCGCAGCAGACCGAAGGATTACCGCCGCT
GCTTATCTGGGGCGCTCCCGAGTGGCATGGTCTGAACGTGAGCGACAAACGGGTGCTTAACGGCGTCTGC
CGCCAGTTGCGCAGCGCGATCTTGCGTCTTGAACCGCGAATTGTGGCGCTGACGGTGAGCGTGAAAGAGG
CGGGCCAGCAGGCATTGGCGCTGCATATCGATGCGCAGCTCTGGCACGACGACGCCCCGCTACAACTGGA
GTTAGCCTGGCGCAACGGTAGTTGGCAATAG