SecReT6
Protein ID: 283787017
SecReT6 ID375
T6SS typei4a
Gene symbolcts2C
Locus tagROD_34211
StrainCitrobacter rodentium ICC168
Repliconchromosome [GenBank: NC_013716] [Browse all T6SS(s) in this replicon]
Location [Strand]3601236..3602957 [+]
ProductT6SS protein Cts2C
NoteTssF
UniProt IDD2TPU9
KEGG IDcro:ROD_34211
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 1.50E-128, Aligned region: 5..559
Protein Sequence: 573 a.a.     [Download]
>gi|283787017|ref|YP_003366882.1| cts2C gene product [Citrobacter rodentium ICC168]
MDDRLLDNYLQELRWLRSVSGDFARRHPQVAARLRLSEFDCPDPHVERLLEGFALQSARLHQRLDDGFGE
LSESLLEQLSPHLMRPFPSTATACFIPDPLAGDLTRGYTMPAGTPLYALNAEGKTVWWRTALEQTLWPVA
IDELAWCDAATAQLHSGLADARSALRIRLRCLAPYRFSQLAMSSLRVHLCGSPQVNAALFDLLYAHAIGP
RRPQPVGVRNASDILPFDAATAASGVALSAWMHCPQALMYFDLPMPPGAEDDTMTLLIPFDCAPPTAQPL
QPDDIRPGCAPLVNLFARTSEPLIAEHTRSEQRLVADHNDSAVQIYRVQALWMSNQESAWRVPPYYSAQG
HSESRWFWHTRRHRMQDNTLWLTLVDSCFDPAEPAEEASLTARLWCSNGETALSLAAGTPLAFALPGPVA
QARLLGTPTAPSSPIARRDARWRLVSSLALNHLSLTDGETALASLKEMLSLYAPSSASSAVWQQINGISD
LRCERVSEHRGGEAWRGWHNGLRVTLTLDPKAFTASSRLLFAAIIARYLARNATANCFVQCVLQDDGRTL
PLWRDTGETALSA
 
Nucleotide Sequence: 1722 bp     [Download]
>gi|283783779|ref|NC_013716.1|:3601236-3602957 Citrobacter rodentium ICC168, complete genome
ATGGACGATCGACTGCTTGATAATTACCTGCAGGAGCTACGCTGGCTGCGTTCGGTTAGCGGCGACTTTG
CCCGCCGTCATCCGCAGGTGGCCGCGCGCCTGCGTTTAAGCGAATTTGACTGCCCGGACCCTCACGTTGA
GCGTCTGCTGGAAGGTTTCGCGTTGCAAAGCGCCCGCCTGCACCAGCGGCTGGACGACGGCTTCGGCGAA
CTGAGCGAGTCGCTGCTGGAACAGCTCTCTCCGCATCTGATGCGTCCTTTTCCCTCAACCGCTACCGCCT
GTTTCATCCCCGATCCGTTAGCAGGCGATCTGACGCGTGGCTATACGATGCCCGCAGGAACGCCGCTGTA
TGCGCTGAACGCCGAAGGGAAAACGGTCTGGTGGCGGACCGCGCTGGAGCAGACCCTGTGGCCGGTGGCG
ATCGACGAGCTTGCCTGGTGCGACGCCGCGACCGCACAGCTTCACAGCGGGCTGGCGGATGCGCGAAGCG
CGTTGCGTATTCGGCTGCGCTGCCTGGCGCCGTATCGTTTTTCGCAACTGGCGATGAGTTCGCTGCGCGT
ACATCTTTGTGGTTCACCGCAGGTTAACGCCGCTCTTTTCGATTTACTTTATGCCCACGCTATCGGACCC
CGGCGTCCGCAGCCCGTGGGCGTACGCAATGCGTCAGATATTTTGCCTTTCGATGCCGCTACGGCGGCCA
GCGGAGTGGCGCTGAGCGCGTGGATGCATTGCCCACAGGCGCTGATGTATTTCGATCTGCCGATGCCGCC
AGGCGCGGAAGACGACACTATGACGTTACTGATCCCGTTTGATTGCGCTCCGCCAACCGCGCAGCCTCTG
CAGCCGGATGATATACGCCCCGGCTGCGCGCCCCTGGTTAATCTTTTTGCCCGCACCTCGGAACCGCTGA
TCGCTGAACATACCCGCAGCGAACAGCGGCTGGTAGCGGACCATAACGACAGCGCCGTGCAGATTTATCG
CGTCCAGGCGCTGTGGATGAGCAATCAGGAGTCGGCATGGCGCGTCCCCCCTTATTATTCGGCGCAGGGA
CACAGTGAAAGCCGCTGGTTCTGGCATACGCGCCGTCATCGCATGCAGGACAATACGCTGTGGTTGACCC
TGGTGGACAGCTGTTTTGATCCGGCAGAGCCAGCGGAGGAGGCCAGTCTGACGGCCCGGCTGTGGTGTAG
CAACGGCGAGACGGCGCTGTCGCTGGCGGCGGGCACCCCTCTCGCATTCGCACTGCCTGGTCCGGTAGCG
CAGGCGCGTCTTCTGGGAACGCCAACGGCGCCTTCCTCTCCCATTGCCCGGCGTGACGCGCGCTGGCGGT
TGGTCTCGTCGCTGGCGCTTAATCATCTGTCGCTCACCGATGGCGAAACGGCGCTCGCTTCGTTGAAGGA
GATGCTGTCGCTCTACGCTCCGTCCAGCGCGTCGTCTGCCGTCTGGCAGCAGATCAACGGCATCAGCGAC
CTGCGCTGCGAACGGGTAAGCGAACATCGCGGCGGCGAGGCCTGGCGCGGGTGGCATAACGGCCTTCGTG
TGACGTTGACGCTCGATCCGAAAGCTTTTACGGCCAGTAGCCGCCTGCTGTTTGCCGCGATTATCGCCCG
CTATCTGGCGCGGAACGCCACGGCGAACTGCTTTGTTCAATGTGTCTTACAGGATGACGGGAGGACGTTG
CCGCTATGGCGCGACACCGGAGAAACGGCGCTATCAGCGTAA