SecReT6
Protein ID: 283787018
SecReT6 ID375
T6SS typei4a
Gene symbolcts2R
Locus tagROD_34221
StrainCitrobacter rodentium ICC168
Repliconchromosome [GenBank: NC_013716] [Browse all T6SS(s) in this replicon]
Location [Strand]3602921..3603856 [+]
ProductT6SS protein Cts2R
NoteTssG
UniProt IDD2TPV0
KEGG IDcro:ROD_34221
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 1.60E-40, Aligned region: 44..291
Protein Sequence: 311 a.a.     [Download]
>gi|283787018|ref|YP_003366883.1| cts2R gene product [Citrobacter rodentium ICC168]
MARHRRNGAISVIERLRREPWSFSLEQYVRLIELSGILPELYGDTGLAFAPAEVGVQRDGHLRVCSLGPG
GADGVLPYDWLEWLQQATQDKNAAPQDFLSLFQRRLIEHHCRSLSLWRLAPPYATREQAPGFAIMRALCG
FDSPAMRYGSPRLLAQSGLLANRRRSTEGFIALAAAVLNVTLRAEEFIGRWQTLPPASQGRIGCRLGRDS
VAGRRAWNQHAALRVHLQVDSETQWRTFLPGGEGFQTLAWLGQVWFGAGITLELVLSGTLALDAMLTRNN
PPRLGRTAQLGGRRKSSFSCRQHLKENTTWT
 
Nucleotide Sequence: 936 bp     [Download]
>gi|283783779|ref|NC_013716.1|:3602921-3603856 Citrobacter rodentium ICC168, complete genome
ATGGCGCGACACCGGAGAAACGGCGCTATCAGCGTAATTGAGCGTCTGCGTCGCGAGCCGTGGAGCTTCT
CGCTGGAGCAATACGTCAGGCTGATTGAACTGAGCGGCATCCTCCCCGAACTGTACGGTGACACGGGACT
GGCCTTCGCGCCTGCGGAGGTTGGCGTACAGCGTGATGGTCATCTGCGGGTATGCAGCCTTGGACCGGGC
GGCGCCGACGGCGTGCTGCCTTACGACTGGCTGGAGTGGCTGCAGCAGGCGACTCAGGATAAAAATGCCG
CTCCGCAGGATTTTCTCAGCCTGTTTCAGCGGCGGCTGATTGAACACCATTGCCGCAGCCTGAGTCTCTG
GCGGCTGGCGCCCCCCTATGCCACGCGGGAACAGGCGCCAGGGTTCGCGATTATGCGCGCGCTGTGCGGC
TTTGATTCACCGGCAATGCGGTATGGATCGCCCCGATTGCTGGCGCAGAGCGGATTGCTGGCAAATCGCA
GGCGTTCGACAGAGGGCTTTATCGCTCTCGCGGCAGCGGTATTGAACGTCACGCTGCGCGCTGAAGAATT
TATTGGTCGCTGGCAGACGTTGCCGCCTGCTTCACAGGGACGTATCGGTTGCCGCCTTGGGCGGGACAGC
GTGGCGGGAAGGCGCGCCTGGAACCAGCATGCGGCTTTGCGGGTGCATCTGCAGGTCGACAGCGAGACGC
AGTGGCGGACATTTTTACCCGGCGGCGAGGGATTTCAGACCCTGGCCTGGCTGGGCCAGGTCTGGTTTGG
CGCAGGAATAACACTGGAACTGGTATTAAGCGGCACGCTGGCGCTCGACGCTATGCTCACCCGCAACAAC
CCGCCGCGACTCGGACGCACCGCACAGCTCGGTGGACGCAGGAAGTCATCATTCAGCTGCCGACAGCATC
TTAAGGAGAATACAACATGGACTTAA