SecReT6
Protein ID: 283787019
SecReT6 ID375
T6SS typei4a
Gene symbolcts2V
Locus tagROD_34231
StrainCitrobacter rodentium ICC168
Repliconchromosome [GenBank: NC_013716] [Browse all T6SS(s) in this replicon]
Location [Strand]3603847..3606354 [+]
ProductT6SS protein Cts2V
NoteTssH
UniProt IDD2TPV1
KEGG IDcro:ROD_34231
PDB IDNA
Domain hit(s) vs Pfam AAA_2 [PF07724], Evalue: 2.40E-38, Aligned region: 215..233
AAA_2 [PF07724], Evalue: 2.40E-38, Aligned region: 603..766
AAA [PF00004], Evalue: 2.20E-21, Aligned region: 215..347
AAA [PF00004], Evalue: 2.20E-21, Aligned region: 609..726
AAA_5 [PF07728], Evalue: 3.80E-16, Aligned region: 215..235
AAA_5 [PF07728], Evalue: 3.80E-16, Aligned region: 289..345
AAA_5 [PF07728], Evalue: 3.80E-16, Aligned region: 608..726
AAA_16 [PF13191], Evalue: 1.50E-11, Aligned region: 192..236
AAA_16 [PF13191], Evalue: 1.50E-11, Aligned region: 259..293
AAA_16 [PF13191], Evalue: 1.50E-11, Aligned region: 401..492
AAA_16 [PF13191], Evalue: 1.50E-11, Aligned region: 584..650
AAA_16 [PF13191], Evalue: 1.50E-11, Aligned region: 673..700
AAA_22 [PF13401], Evalue: 8.60E-11, Aligned region: 215..296
AAA_22 [PF13401], Evalue: 8.60E-11, Aligned region: 331..387
AAA_22 [PF13401], Evalue: 8.60E-11, Aligned region: 559..591
AAA_22 [PF13401], Evalue: 8.60E-11, Aligned region: 606..713
Clp_N [PF02861], Evalue: 3.00E-10, Aligned region: 24..69
AAA_17 [PF13207], Evalue: 1.40E-08, Aligned region: 166..210
AAA_17 [PF13207], Evalue: 1.40E-08, Aligned region: 215..267
AAA_17 [PF13207], Evalue: 1.40E-08, Aligned region: 607..646
Zeta_toxin [PF06414], Evalue: 2.50E-07, Aligned region: 215..235
Zeta_toxin [PF06414], Evalue: 2.50E-07, Aligned region: 600..648
AAA_25 [PF13481], Evalue: 4.40E-07, Aligned region: 215..278
AAA_25 [PF13481], Evalue: 4.40E-07, Aligned region: 605..633
AAA_14 [PF13173], Evalue: 1.20E-06, Aligned region: 215..318
AAA_14 [PF13173], Evalue: 1.20E-06, Aligned region: 607..698
IstB_IS21 [PF01695], Evalue: 2.40E-06, Aligned region: 208..234
IstB_IS21 [PF01695], Evalue: 2.40E-06, Aligned region: 608..628
AAA_18 [PF13238], Evalue: 4.30E-06, Aligned region: 215..248
AAA_18 [PF13238], Evalue: 4.30E-06, Aligned region: 333..391
AAA_18 [PF13238], Evalue: 4.30E-06, Aligned region: 609..639
Sigma54_activat [PF00158], Evalue: 7.00E-06, Aligned region: 196..231
Sigma54_activat [PF00158], Evalue: 7.00E-06, Aligned region: 608..707
AAA_19 [PF13245], Evalue: 1.30E-05, Aligned region: 212..238
AAA_19 [PF13245], Evalue: 1.30E-05, Aligned region: 606..630
ResIII [PF04851], Evalue: 4.30E-05, Aligned region: 205..236
ResIII [PF04851], Evalue: 4.30E-05, Aligned region: 282..297
ResIII [PF04851], Evalue: 4.30E-05, Aligned region: 608..630
T2SE [PF00437], Evalue: 4.60E-05, Aligned region: 203..230
T2SE [PF00437], Evalue: 4.60E-05, Aligned region: 593..686
NACHT [PF05729], Evalue: 0.00015, Aligned region: 215..241
NACHT [PF05729], Evalue: 0.00015, Aligned region: 434..487
NACHT [PF05729], Evalue: 0.00015, Aligned region: 608..634
Arch_ATPase [PF01637], Evalue: 0.00023, Aligned region: 193..227
Arch_ATPase [PF01637], Evalue: 0.00023, Aligned region: 267..369
Arch_ATPase [PF01637], Evalue: 0.00023, Aligned region: 607..650
SRP54 [PF00448], Evalue: 0.00059, Aligned region: 215..236
SRP54 [PF00448], Evalue: 0.00059, Aligned region: 352..385
SRP54 [PF00448], Evalue: 0.00059, Aligned region: 607..644
RNA_helicase [PF00910], Evalue: 0.00077, Aligned region: 216..237
RNA_helicase [PF00910], Evalue: 0.00077, Aligned region: 609..630
AAA_33 [PF13671], Evalue: 0.0017, Aligned region: 215..232
AAA_33 [PF13671], Evalue: 0.0017, Aligned region: 607..630
RuvB_N [PF05496], Evalue: 0.0019, Aligned region: 214..232
RuvB_N [PF05496], Evalue: 0.0019, Aligned region: 283..295
RuvB_N [PF05496], Evalue: 0.0019, Aligned region: 575..629
RuvB_N [PF05496], Evalue: 0.0019, Aligned region: 677..701
AAA_23 [PF13476], Evalue: 0.0068, Aligned region: 215..232
AAA_23 [PF13476], Evalue: 0.0068, Aligned region: 449..480
AAA_23 [PF13476], Evalue: 0.0068, Aligned region: 606..633
AAA_29 [PF13555], Evalue: 0.0074, Aligned region: 207..227
AAA_29 [PF13555], Evalue: 0.0074, Aligned region: 604..633
Protein Sequence: 835 a.a.     [Download]
>gi|283787019|ref|YP_003366884.1| cts2V gene product [Citrobacter rodentium ICC168]
MDLKALVQRLNPVCLYALEQAAGRSRAQGHWFVEPEHLLLALLDDEHCDLACCLDGAGIPVDALRDEIRR
AQSQFRTGCTRMPVFSAQLVELLEGALLLTTFRQLKQVRSALLLLTLLTRDRLRAQLAQGLPLLLKISAE
QLEDHWLNWCRGSAEAVSDRSDADAAVRGDSVLDQYTHDLTREARQGRIDPIIGRDAEIRQCIDILLRRR
QNNPILVGAPGVGKTAVAEGLALRIAEGSVPPPLRDVALLSLDLGLLQAGAGVKGEFEQRLKGVIEAVKK
SSQPIVLFIDEAHTLIGAGGAEGGSDAANLLKPALARGELRTIAATTWQEYKKYFEKDPALDRRFQRIHI
EEPDEDSAVMMLRAVADKLEAHHGVQILDTAIREAVRLSQRYISGRQLPDKAISVLDTACSRVALAQHDI
PPALEEVRQQLATIEEESVRLNRELLVGIDHHDRLCDLEAQAKLLQLQAQEVEERWQDERQRVGELLAAR
QRMLALNARLDDEEELEQELVECAALIGKLETAAVQLRDEVPLVPDCVDAATVAAVIGGWTGIPIGQMLT
DEAHALRTLVERMSERVMGQRAALETIARRLRAYRSGLTDPQKPVGVFLLVGPTGVGKTETAYALADALY
GGERNLITINLSEYQEAHTVSQLKGAPPGYVGYGSGGALTEAVRRRPYSVVLLDEIEKAHPDVLEAFYNV
FDKGVMEDGTGLIVDFKNTVMLATSNVGAELILETPTSEFNSEWFNTAMREELLRHFRPAFLARMTTVAY
RALDEETLKGIVLAKLEKLAQRYLVATGEKLNMEDGLVERVMDQCKGVGARDIENLVIGAVMGDK
 
Nucleotide Sequence: 2508 bp     [Download]
>gi|283783779|ref|NC_013716.1|:3603847-3606354 Citrobacter rodentium ICC168, complete genome
ATGGACTTAAAAGCGCTGGTACAGCGGCTGAACCCGGTTTGTCTGTACGCGCTGGAACAGGCCGCCGGGC
GTAGCCGGGCGCAGGGGCACTGGTTTGTGGAGCCGGAACATCTGCTGCTGGCATTGCTGGACGACGAGCA
CTGCGATCTGGCGTGCTGCCTTGACGGCGCGGGGATTCCTGTCGACGCGCTGCGCGATGAGATCCGGCGC
GCCCAGTCGCAGTTCAGAACCGGCTGTACGCGAATGCCGGTCTTTTCTGCGCAGTTGGTGGAGCTGCTGG
AGGGGGCGCTGTTACTGACCACTTTCCGTCAGTTGAAGCAGGTGCGCTCCGCGCTGCTGCTGCTGACTCT
GCTCACCCGCGATCGCCTGCGCGCCCAGTTGGCGCAGGGGCTACCGCTGCTGTTAAAGATCTCCGCAGAA
CAACTGGAAGATCATTGGCTGAATTGGTGTCGTGGATCCGCTGAAGCGGTGAGCGATAGATCGGACGCTG
ACGCGGCGGTTCGCGGCGACAGCGTGCTGGATCAATACACACACGATCTTACCCGTGAAGCCCGGCAAGG
ACGGATCGACCCGATCATCGGGCGTGATGCTGAAATCCGTCAGTGCATTGACATTCTGCTGCGCCGTCGG
CAGAACAACCCGATTCTGGTAGGCGCGCCGGGCGTCGGGAAAACCGCCGTCGCCGAAGGGCTGGCGCTGC
GTATCGCCGAAGGCAGCGTGCCGCCGCCTCTGCGTGATGTGGCGCTGCTTTCACTCGATCTCGGCCTGTT
ACAGGCGGGGGCGGGAGTGAAAGGCGAATTTGAGCAGCGCCTGAAAGGGGTGATTGAGGCGGTCAAAAAA
TCCTCTCAGCCGATCGTCTTGTTTATCGACGAAGCCCATACGCTGATTGGCGCAGGCGGCGCCGAGGGCG
GCAGCGATGCCGCCAACCTGCTGAAGCCAGCGCTGGCGCGTGGCGAGCTGCGAACCATTGCCGCTACCAC
CTGGCAGGAGTACAAAAAATATTTTGAGAAGGACCCGGCGCTGGATCGCCGTTTTCAGCGCATTCATATT
GAAGAGCCGGACGAGGATAGCGCGGTGATGATGCTGCGGGCGGTGGCCGATAAGCTGGAAGCGCACCACG
GGGTGCAGATTCTGGATACCGCTATTCGAGAGGCGGTGCGCCTGTCGCAACGCTACATCTCCGGGCGTCA
GCTACCGGATAAGGCTATCAGCGTCCTTGATACCGCCTGTTCGCGGGTGGCGCTGGCGCAGCATGATATC
CCTCCGGCGTTGGAGGAGGTTCGCCAGCAGCTGGCTACCATTGAGGAAGAGAGCGTGCGTCTGAATCGCG
AGCTGCTGGTGGGCATCGATCATCACGATCGGCTATGCGATCTGGAGGCGCAGGCGAAGCTGTTGCAGCT
TCAGGCGCAGGAGGTGGAGGAACGCTGGCAGGATGAACGCCAGCGGGTCGGCGAACTGCTGGCTGCCCGT
CAACGGATGCTGGCGCTGAACGCGCGGCTGGACGACGAGGAAGAACTGGAACAGGAGCTGGTGGAGTGCG
CGGCACTGATCGGCAAACTGGAAACCGCCGCCGTCCAACTCCGCGATGAAGTGCCGCTGGTACCAGACTG
CGTTGATGCCGCCACCGTTGCAGCAGTGATCGGCGGCTGGACCGGGATACCGATCGGGCAGATGCTTACT
GATGAAGCGCACGCGCTGCGTACGCTGGTCGAACGGATGAGCGAGCGGGTGATGGGGCAACGGGCAGCGC
TTGAGACTATCGCCCGGCGGCTGCGCGCCTACCGCAGCGGCCTGACCGATCCGCAAAAGCCGGTTGGCGT
ATTCCTGCTGGTGGGGCCAACCGGCGTTGGCAAAACTGAAACCGCCTATGCGCTGGCCGATGCGCTCTAC
GGCGGCGAACGAAATCTCATCACCATCAACCTCTCCGAATACCAGGAAGCGCACACCGTCAGCCAGTTAA
AAGGCGCGCCGCCGGGTTACGTCGGCTATGGCAGCGGTGGGGCGCTAACTGAAGCCGTGCGCCGCCGTCC
TTACTCTGTGGTTCTGCTGGATGAAATCGAAAAGGCGCATCCGGACGTGCTGGAGGCGTTTTATAACGTC
TTCGACAAAGGCGTCATGGAGGACGGTACCGGATTAATTGTCGACTTCAAAAACACGGTGATGCTGGCGA
CCAGCAACGTCGGGGCGGAGTTAATTCTTGAAACGCCGACTTCTGAATTCAATAGCGAGTGGTTTAATAC
GGCGATGCGCGAAGAGTTGTTGCGCCATTTTCGTCCGGCGTTTTTAGCGAGGATGACCACAGTAGCCTAT
CGCGCGTTGGATGAAGAAACATTAAAAGGCATTGTGCTGGCGAAACTGGAGAAATTAGCTCAACGGTATC
TGGTGGCGACAGGTGAGAAATTAAATATGGAGGATGGGCTGGTCGAAAGGGTAATGGATCAATGTAAGGG
AGTGGGGGCCAGAGATATTGAGAATCTGGTGATTGGGGCAGTAATGGGCGATAAATAA