SecReT6
Protein ID: 283787020
SecReT6 ID375
T6SS typei4a
Gene symbolcts2G
Locus tagROD_34241
StrainCitrobacter rodentium ICC168
Repliconchromosome [GenBank: NC_013716] [Browse all T6SS(s) in this replicon]
Location [Strand]3606559..3608523 [+]
ProductVgrG family T6SS protein Cts2G
NoteTssI
UniProt IDD2TPV2
KEGG IDcro:ROD_34241
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 3.60E-67, Aligned region: 32..313
Phage_base_V [PF04717], Evalue: 3.40E-25, Aligned region: 342..435
Gp5_C [PF06715], Evalue: 3.20E-15, Aligned region: 489..513
Gp5_C [PF06715], Evalue: 3.20E-15, Aligned region: 524..546
Gp5_C [PF06715], Evalue: 3.20E-15, Aligned region: 548..571
Gp5_C [PF06715], Evalue: 3.20E-15, Aligned region: 564..584
Gp5_C [PF06715], Evalue: 3.20E-15, Aligned region: 626..640
Protein Sequence: 654 a.a.     [Download]
>gi|283787020|ref|YP_003366885.1| cts2G gene product [Citrobacter rodentium ICC168]
MSDTAIIRLSAPLLTGLTVSSAQTESQLNALTTATVAGTSCAPLTLDSALATHLTATINNADYDGLIAGA
YQLPATGNADRYQFVLRPWLWWLTLSSNNRVFQNLNVQEIVGNIFKDAGFSDYKFQLKTTPVKREYCLQY
NESDFNFVSRLLEQEGIFWFFTHQEGKHTLVLADDNSAFPPIPGDKKVKYQAAQSGEREIGAIRSAELRL
QATAQGFQSSDYNYEQPKAPLFSWAGEQKGGMHYQHPGRFSAKDAGDALAAWKVNALKTQAKQLVGESDC
AALMAGHWFTLTDHDDKSLNIDWLIIAVNHEYDGSRYHNRFTAIPKSTPYRPLSATPAPFMHTQTATVVG
KSGEEIWTDKLGRVKVQFPWDREGNNNETSSCWLRVATAWSGNGFGAQFIPRIGQEVVVSFIDGDPDKPL
ITGCVYNGANALPYALPANQTQSGIKTKSEKGFNELRFDDKKDAELLAMQAQKDFHLMVLNDSKTTIGHD
EIHSVKNDRTHTVEEGNETVTVKKGHRTVKIEKGSDTLEVKDKRSVTVEGDQEHAVEGNETHKVKGNYTL
NVDGNLTIKVNGTLTLESGKNLEVKSGANLNARASASLKMNATSIASEAESSLTQKAATISQEAKATLTS
KASATQTVDGGGMLVIKGGMVKIN
 
Nucleotide Sequence: 1965 bp     [Download]
>gi|283783779|ref|NC_013716.1|:3606559-3608523 Citrobacter rodentium ICC168, complete genome
ATGTCCGATACCGCCATTATCAGACTCAGCGCTCCATTGCTGACCGGCCTGACTGTCTCCTCAGCGCAGA
CTGAATCACAGCTCAACGCGCTCACTACCGCCACCGTCGCAGGAACCAGCTGTGCGCCGTTAACGTTAGA
CAGCGCGCTGGCAACCCATCTGACCGCCACGATAAACAATGCCGACTACGATGGGCTGATTGCCGGGGCG
TACCAGCTTCCGGCGACCGGTAACGCTGACCGCTATCAGTTTGTGTTACGTCCGTGGTTGTGGTGGCTGA
CGCTCTCCAGCAATAACCGCGTTTTTCAGAACCTGAACGTTCAGGAGATTGTCGGAAATATATTTAAAGA
TGCAGGTTTTTCCGATTATAAATTCCAGCTTAAAACCACACCGGTGAAGCGTGAATACTGTCTGCAATAT
AATGAAAGCGACTTTAATTTTGTTTCCCGTCTGCTGGAGCAGGAGGGGATCTTCTGGTTCTTCACTCATC
AGGAAGGTAAGCATACGCTGGTGCTGGCTGACGATAACAGCGCCTTCCCGCCGATTCCAGGCGACAAAAA
GGTAAAATATCAGGCTGCGCAGAGCGGTGAGCGGGAAATCGGGGCGATTCGCTCGGCAGAGCTGCGTTTA
CAGGCTACCGCTCAGGGCTTCCAGAGCAGCGATTATAATTACGAGCAGCCGAAAGCGCCGCTGTTCTCCT
GGGCGGGTGAACAGAAGGGGGGCATGCACTATCAGCATCCGGGGCGCTTTAGCGCCAAAGACGCTGGCGA
TGCGCTGGCGGCGTGGAAGGTTAATGCGCTGAAGACGCAGGCGAAACAGCTGGTAGGTGAAAGCGACTGC
GCGGCGCTGATGGCCGGGCACTGGTTTACGCTTACCGATCATGACGACAAATCCCTGAACATCGACTGGC
TGATTATCGCGGTTAACCATGAATATGATGGTTCCCGATACCATAACCGTTTTACCGCCATTCCGAAGTC
CACGCCGTATCGTCCGCTGTCCGCGACGCCTGCGCCGTTTATGCATACGCAAACGGCGACGGTGGTTGGC
AAAAGCGGCGAAGAGATCTGGACCGACAAACTTGGGCGGGTAAAAGTGCAGTTCCCGTGGGACAGAGAAG
GCAATAATAACGAAACCAGCTCCTGCTGGTTACGGGTAGCTACCGCCTGGAGCGGCAACGGATTTGGCGC
GCAGTTTATCCCGCGTATCGGCCAGGAGGTCGTCGTGAGCTTTATCGACGGCGACCCGGATAAGCCGTTG
ATAACAGGCTGCGTCTACAACGGCGCGAATGCCTTGCCGTATGCGCTGCCGGCAAACCAGACCCAGTCCG
GCATTAAAACGAAAAGTGAAAAAGGCTTCAATGAACTGCGCTTCGACGACAAAAAAGACGCCGAGTTACT
GGCTATGCAGGCGCAGAAAGATTTTCATCTTATGGTGCTTAACGACAGCAAAACCACCATCGGCCACGAT
GAGATTCACAGCGTCAAAAACGATCGCACCCACACCGTTGAAGAGGGGAACGAAACCGTCACCGTGAAAA
AAGGTCACCGGACGGTAAAAATCGAGAAGGGTAGCGACACGCTGGAGGTGAAGGACAAGCGCAGTGTGAC
GGTGGAGGGCGATCAGGAACACGCGGTGGAGGGTAACGAAACGCATAAGGTAAAAGGCAACTATACCCTC
AATGTTGACGGCAATCTGACCATTAAGGTAAACGGCACGCTAACCCTGGAAAGCGGTAAAAATTTGGAGG
TGAAGAGCGGGGCAAATCTTAACGCCAGAGCTTCGGCCAGCCTGAAAATGAACGCCACTAGCATTGCCAG
CGAAGCAGAATCCTCTTTGACTCAGAAAGCCGCCACCATTAGCCAGGAAGCGAAAGCGACCCTGACCAGC
AAAGCCAGCGCCACCCAGACCGTAGACGGCGGCGGTATGTTGGTGATTAAAGGCGGGATGGTGAAGATCA
ACTGA