SecReT6
Protein ID: 284038954
SecReT6 ID914
T6SS typeiii
Gene symbol-
Locus tagSlin_4098
StrainSpirosoma linguale DSM 74
Repliconchromosome [GenBank: NC_013730] [Browse all T6SS(s) in this replicon]
Location [Strand]4932530..4933816 [-]
Producthypothetical protein
NoteTssC
UniProt IDD2QJN9
KEGG IDsli:Slin_4098
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 1.40E-10, Aligned region: 41..62
DUF877 [PF05943], Evalue: 1.40E-10, Aligned region: 90..229
DUF877 [PF05943], Evalue: 1.40E-10, Aligned region: 319..404
Phage_sheath_1 [PF04984], Evalue: 0.0055, Aligned region: 321..407
Protein Sequence: 428 a.a.     [Download]
>gi|284038954|ref|YP_003388884.1| hypothetical protein Slin_4098 [Spirosoma linguale DSM 74]
MSLLTDHGFEFVESLLDGSLSGSLDFANRTTNFLRRPVKEKERATLQEKLKAWIAVLSASDSLDEMLTIA
DQKAAQSEESLRKNLLTTLEATRELETNYRALSLFYTSTETARIPNISVVNAGLDQVCDLENAHFTEHIA
DELKQNYDRLDLRDNYSLLVIPGFMRSNVVLEKWAKIAHANKVMLFTDFADLDGPDDVLELLSAVNMTGA
ELFRSNVIMTCNWLVGRSKVAEVGEMDHLYIPPSAALAGKTYYTPMPQVSAGKRYGGISEVLGVRFRLWK
NEVSIMERLNLVPMIEEHGQVMAYGSKTLFNGPNIGLQTFTVVRVFDYIVKVLFDFLNRRAFENWNTSIE
GDLRRQIAVFLDSVKGSDKLIEQFRIVRLEQDRKQKDRVYLDIRLTPYFPAKSFIVRLDGQRDGETESPD
WASSYELA
 
Nucleotide Sequence: 1287 bp     [Download]
>gi|284034943|ref|NC_013730.1|:c4933816-4932530 Spirosoma linguale DSM 74 chromosome, complete genome
ATGTCTTTGCTGACTGATCATGGATTTGAGTTTGTTGAAAGCCTTCTGGATGGTTCGTTAAGCGGGAGTC
TGGACTTCGCCAACCGTACGACCAATTTTTTGAGGAGGCCGGTTAAAGAAAAAGAACGGGCCACCTTACA
GGAGAAACTGAAGGCCTGGATTGCGGTGCTGAGTGCGTCTGATAGTCTGGACGAGATGCTCACCATTGCC
GATCAAAAAGCAGCGCAGTCCGAAGAAAGTCTGCGCAAAAACCTGCTGACCACCCTGGAAGCCACGCGCG
AACTTGAGACCAATTACCGGGCGCTTTCACTTTTTTATACCAGTACCGAAACAGCCCGGATTCCCAATAT
TTCGGTGGTAAATGCTGGTCTGGACCAAGTGTGTGATCTGGAAAATGCACATTTTACTGAGCACATTGCT
GATGAGTTAAAGCAGAATTACGACCGCCTTGACCTTCGGGATAATTACTCCCTTCTGGTAATACCCGGTT
TTATGCGGTCGAATGTCGTGCTGGAGAAATGGGCTAAAATTGCCCATGCCAACAAGGTCATGCTCTTCAC
CGACTTTGCGGATCTGGACGGCCCCGACGATGTACTTGAGCTGCTCAGTGCCGTCAATATGACGGGTGCG
GAGTTGTTTCGTTCCAATGTAATCATGACCTGCAACTGGCTTGTTGGCCGGAGTAAGGTGGCCGAAGTAG
GCGAAATGGATCACCTGTATATCCCGCCGTCTGCGGCCCTTGCCGGCAAAACGTATTACACGCCAATGCC
GCAGGTGTCGGCGGGAAAGCGATACGGTGGTATAAGTGAGGTGCTGGGTGTCCGGTTTCGGCTTTGGAAA
AATGAAGTCTCTATCATGGAACGACTTAATCTCGTGCCCATGATTGAGGAGCATGGCCAGGTAATGGCTT
ATGGCAGCAAAACCCTGTTCAACGGACCTAATATTGGTTTGCAGACCTTTACAGTTGTTCGGGTGTTCGA
CTACATTGTGAAAGTGCTGTTTGACTTTTTGAACCGCCGGGCTTTCGAAAACTGGAATACCAGCATAGAA
GGTGATTTGCGACGACAGATTGCCGTGTTTCTGGACAGTGTAAAAGGGTCTGATAAACTGATTGAGCAGT
TTAGAATTGTACGGCTCGAACAGGACCGCAAACAGAAAGATCGCGTTTATCTGGATATTCGCCTGACGCC
TTATTTCCCGGCCAAAAGTTTTATAGTCCGGCTCGACGGCCAGCGGGATGGCGAAACCGAAAGTCCAGAC
TGGGCTTCCAGCTACGAACTGGCTTAA