SecReT6
Protein ID: 284038955
SecReT6 ID914
T6SS typeiii
Gene symbol-
Locus tagSlin_4099
StrainSpirosoma linguale DSM 74
Repliconchromosome [GenBank: NC_013730] [Browse all T6SS(s) in this replicon]
Location [Strand]4934280..4934738 [-]
Producthypothetical protein
NoteTssB
UniProt IDD2QJP0
KEGG IDsli:Slin_4099
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 152 a.a.     [Download]
>gi|284038955|ref|YP_003388885.1| hypothetical protein Slin_4099 [Spirosoma linguale DSM 74]
MFDFEIGGSEARPRALEEISNIPSNRTLLVLKLTQKDPVRPETLYGLNTVDAVFNHFRPEVEVEMESPAG
MPTKETIRFRRIADFRVKELVAQSPFLRSLDTQYQEYTQIGRRLNGHALLRTMLGNAETKAILLKTLQAA
ADELTKTGKAGQ
 
Nucleotide Sequence: 459 bp     [Download]
>gi|284034943|ref|NC_013730.1|:c4934738-4934280 Spirosoma linguale DSM 74 chromosome, complete genome
ATGTTTGACTTCGAAATTGGTGGTAGTGAGGCCAGACCCCGGGCGTTGGAAGAAATCAGTAACATCCCTT
CGAACCGGACGTTACTGGTGCTGAAACTTACCCAAAAGGACCCCGTCAGGCCGGAGACGCTCTACGGCCT
GAACACGGTCGACGCCGTGTTCAATCACTTCAGGCCCGAAGTGGAGGTGGAAATGGAGTCGCCTGCGGGT
ATGCCCACGAAAGAAACTATCCGGTTTCGGCGAATAGCCGATTTTCGGGTCAAGGAGCTGGTAGCCCAGA
GTCCATTCCTGCGATCGCTGGATACGCAGTATCAGGAGTACACGCAGATTGGCCGCCGACTAAATGGACA
CGCGCTCCTGCGAACCATGTTGGGTAATGCCGAAACGAAGGCCATCCTGCTAAAAACGCTACAGGCTGCG
GCCGATGAGCTGACGAAAACGGGCAAAGCCGGTCAATAA