SecReT6
Protein ID: 284038958
SecReT6 ID914
T6SS typeiii
Gene symbol-
Locus tagSlin_4102
StrainSpirosoma linguale DSM 74
Repliconchromosome [GenBank: NC_013730] [Browse all T6SS(s) in this replicon]
Location [Strand]4939907..4940794 [-]
ProductPKD domain-containing protein
NoteTssP
UniProt IDD2QJP3
KEGG IDsli:Slin_4102
PDB IDNA
Domain hit(s) vs Pfam PKD [PF00801], Evalue: 2.40E-06, Aligned region: 43..94
PKD [PF00801], Evalue: 2.40E-06, Aligned region: 125..168
Protein Sequence: 295 a.a.     [Download]
>gi|284038958|ref|YP_003388888.1| PKD domain-containing protein [Spirosoma linguale DSM 74]
MNSKMTLSARALFFTLIVLSGLYQYTAEPTIRAKVEPIQQVAGQPIRYVDSTDADGRRHWEFGNGQDSRV
AKGEFYYSQPGTYLIRLTIDNNLTKTFSVVVTPRKIVQTQDSLVKIKGPATGYEREKLVFTAEGGGARQF
SWRFGASGQIDSRDQTAIYSYPAVDSYTPFQVYKIELMTDVTKYPVVKEVRIFKGFNKFAPTIDSLDITG
SDFKRRLQLIADGQSFNVHYNYLLKRYLCEKNSTIVRINDAKTNDFYSYCMGLQFDRGVRIDGVAVIADS
LTSCLVRLNVTQHNQ
 
Nucleotide Sequence: 888 bp     [Download]
>gi|284034943|ref|NC_013730.1|:c4940794-4939907 Spirosoma linguale DSM 74 chromosome, complete genome
ATGAATAGCAAAATGACCTTATCGGCACGGGCGCTGTTTTTTACCCTGATCGTACTGTCGGGGCTTTATC
AGTATACGGCTGAGCCTACCATTCGGGCCAAAGTGGAACCCATCCAGCAGGTAGCCGGTCAGCCCATACG
CTATGTAGACAGTACAGACGCGGACGGCAGGCGGCACTGGGAGTTCGGAAACGGGCAGGATTCCAGGGTG
GCCAAGGGTGAGTTTTATTATTCCCAACCCGGTACGTACCTGATTCGGCTGACAATTGACAATAACCTGA
CCAAAACGTTTTCTGTTGTGGTTACGCCCCGCAAAATTGTGCAGACGCAGGATTCGCTGGTGAAGATCAA
AGGACCGGCAACGGGCTATGAGCGCGAAAAACTGGTATTTACCGCCGAAGGGGGAGGGGCCCGTCAGTTT
TCCTGGCGCTTTGGGGCCAGTGGTCAGATTGACTCGCGCGACCAGACGGCCATCTACAGTTATCCGGCAG
TAGACAGCTATACGCCCTTTCAGGTGTACAAAATCGAACTCATGACAGACGTGACCAAGTATCCGGTCGT
CAAAGAGGTTCGGATTTTTAAAGGGTTCAACAAATTCGCGCCTACCATCGATTCGCTCGATATTACGGGG
AGTGATTTCAAAAGACGGCTACAGCTTATTGCAGACGGGCAATCGTTCAACGTGCATTACAATTATTTGT
TGAAGCGGTATTTGTGCGAGAAGAACAGTACAATCGTGCGCATCAACGATGCGAAAACCAACGACTTTTA
TTCGTACTGTATGGGCTTGCAATTCGATCGGGGCGTACGGATCGATGGGGTAGCGGTAATCGCTGATTCG
CTCACCTCCTGTCTTGTGCGCCTAAACGTGACCCAGCATAACCAATGA