SecReT6
Protein ID: 284038961
SecReT6 ID914
T6SS typeiii
Gene symbol-
Locus tagSlin_4105
StrainSpirosoma linguale DSM 74
Repliconchromosome [GenBank: NC_013730] [Browse all T6SS(s) in this replicon]
Location [Strand]4941909..4942853 [+]
Producthypothetical protein
NoteTssG
UniProt IDD2QJP6
KEGG IDsli:Slin_4105
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 5.80E-15, Aligned region: 139..314
Protein Sequence: 314 a.a.     [Download]
>gi|284038961|ref|YP_003388891.1| hypothetical protein Slin_4105 [Spirosoma linguale DSM 74]
MTISTQPSSLQPYFLDLLDVDFKAELLAASLADQQIPPERIIINPTGLYNRAYSKDILEMNDWLLEGSTF
IYNRIDTPREGLFDMLPQYLFFPPKDLSKLADTDQTLDTIRQDRDHERQARLFFLPFDAELNYLRTLAVQ
HESAVEHPDTARTIIDQFAEQWPIIKDMNRMQTGLFLQVLPWMHLLRSNLVWLSQFLQVFFAVPVKVEAG
HQIYQSTQADGDLPTLANCRLGIDAVIGDRFDDGRNGVQIIIGPVPDAQVPLFLPHAQSIALLHTLVNYF
LPVSIDFSVSVLTSPKAQDAPQPNDVYLGYTSFL
 
Nucleotide Sequence: 945 bp     [Download]
>gi|284034943|ref|NC_013730.1|:4941909-4942853 Spirosoma linguale DSM 74 chromosome, complete genome
ATGACAATCTCCACTCAACCGTCAAGTTTACAGCCTTATTTTCTCGATCTGCTCGATGTAGACTTCAAAG
CCGAACTTCTGGCAGCCTCACTGGCCGATCAGCAGATACCCCCGGAACGAATTATCATCAACCCAACCGG
CCTGTATAACCGCGCCTACTCCAAAGATATACTGGAGATGAACGACTGGCTGCTGGAAGGGTCCACCTTT
ATTTACAACCGTATCGATACGCCCCGCGAAGGCTTGTTCGATATGCTGCCGCAATACCTGTTCTTCCCAC
CCAAAGACTTATCCAAACTTGCCGACACCGACCAGACCCTCGATACCATTCGGCAGGATCGCGATCACGA
ACGGCAGGCCCGGCTTTTTTTCCTGCCATTCGATGCCGAACTGAACTACCTCCGAACCCTGGCCGTCCAG
CACGAAAGCGCCGTTGAACATCCGGACACGGCCAGAACCATTATCGATCAGTTTGCCGAACAATGGCCTA
TTATCAAGGACATGAACCGGATGCAGACGGGTCTTTTTTTACAAGTACTACCCTGGATGCACCTGCTTCG
CAGCAATCTTGTCTGGTTAAGTCAGTTTTTACAAGTCTTCTTTGCCGTTCCGGTAAAGGTTGAAGCAGGC
CATCAAATCTACCAGTCAACCCAGGCCGATGGTGATTTACCCACACTGGCCAATTGTCGGCTAGGCATCG
ATGCGGTAATAGGTGACCGTTTCGACGACGGCCGCAACGGCGTACAGATCATCATCGGTCCAGTTCCGGA
TGCCCAGGTACCGCTTTTTCTGCCACACGCTCAATCGATTGCTTTGTTGCATACGCTTGTTAATTATTTC
CTTCCTGTCTCTATTGACTTTTCTGTTTCTGTCCTAACCTCACCAAAAGCCCAGGACGCTCCCCAGCCAA
ACGATGTGTATCTGGGTTACACCAGTTTTCTCTAG