SecReT6
Protein ID: 284038963
SecReT6 ID914
T6SS typeiii
Gene symbol-
Locus tagSlin_4107
StrainSpirosoma linguale DSM 74
Repliconchromosome [GenBank: NC_013730] [Browse all T6SS(s) in this replicon]
Location [Strand]4944556..4946451 [-]
Producthypothetical protein
NoteTssF
UniProt IDD2QJP8
KEGG IDsli:Slin_4107
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 631 a.a.     [Download]
>gi|284038963|ref|YP_003388893.1| hypothetical protein Slin_4107 [Spirosoma linguale DSM 74]
MPLSDQRSFFSKESIQQRLLLHIMQMWGVQDLNHLDSFVQMLIDTLANEVYRISNAFMESEVRVLERLAD
LLTPDLMTIPRPAHAVVQANPGQPVVELTPVQSLLFQQKYASQQLGELDSVQDLFFSPVESVKLIDGRVA
YLASGSQLQSIHTQLGKRLVAQTLPLQKLAPKTLWIGLEINPAVDSLDRVSFFFNWPDDIEHQPLLSLLS
LSRWSLNGNPITTAIGSASQEASQIDMDDTTRLFSEYDVNYQLEQDIRQNYQRRFIHIEQPMTQPLAGVV
QPYPPAFAAAFGAQNLKALESGTLVWLEVAFPARFTEEVLEKVSVELNAFPVLNRKLNRILYRTMANFNL
LPLRTDPFETLLMVKAVVDSKDRVFIPHPFHKAEDISSGGYAVRRGGVERFDVRNAREQLTFLLELLRDE
SVAFAVYGQDTIRLLLTQLQDQIERLERKIQNTNMPPLTINQYVTFKPFEAGDSMQVDFWTTTCELANNI
PAGTYLQAYNTNSLAGDSIKLLTGTTGGRSRPSALHRVQTYRYALMTHQRIITQEDVRAFFYHELGPLLK
SVTIRKGVAIGKTVKEGLMRTVDIIVKPAEDCTLTESEWKVVLESVHQKLIQRSGQVTTYRLFLDEVLLP
V
 
Nucleotide Sequence: 1896 bp     [Download]
>gi|284034943|ref|NC_013730.1|:c4946451-4944556 Spirosoma linguale DSM 74 chromosome, complete genome
ATGCCACTGAGCGACCAGCGGTCTTTTTTTTCTAAAGAGTCTATACAGCAGCGTTTGTTATTGCACATTA
TGCAAATGTGGGGTGTCCAGGATTTGAATCACCTGGATTCATTCGTGCAGATGCTGATTGATACTCTGGC
TAACGAAGTTTACCGGATCAGTAATGCGTTTATGGAGTCGGAGGTGCGCGTTCTGGAGCGGCTGGCCGAT
CTGCTGACGCCCGACCTGATGACCATACCCCGCCCGGCCCATGCTGTTGTTCAGGCCAATCCTGGCCAGC
CGGTTGTTGAATTAACGCCGGTTCAGAGTCTGCTTTTTCAGCAGAAGTATGCCTCTCAACAATTGGGTGA
GCTGGATAGTGTTCAGGACCTGTTCTTTTCGCCCGTCGAGTCGGTCAAGCTTATTGATGGCCGGGTGGCT
TATCTGGCTTCGGGTTCACAACTACAATCCATTCACACCCAGTTGGGTAAACGCCTGGTCGCCCAAACGC
TGCCCCTGCAAAAACTGGCGCCTAAAACGCTGTGGATCGGGTTAGAAATTAACCCGGCCGTCGACTCGCT
CGATCGGGTGAGTTTCTTCTTCAACTGGCCCGACGATATAGAGCACCAGCCCTTGTTGTCGCTGCTTAGT
CTGAGCCGCTGGTCCTTGAACGGAAACCCGATAACGACGGCCATCGGTTCTGCCAGTCAGGAGGCCAGCC
AGATCGATATGGATGATACGACCCGGCTGTTTTCGGAATACGACGTCAATTACCAGCTCGAACAGGATAT
TCGTCAGAATTACCAGCGTCGGTTTATCCATATCGAGCAGCCGATGACGCAGCCGTTGGCGGGTGTCGTG
CAACCGTATCCACCCGCCTTTGCTGCCGCCTTTGGTGCTCAAAATTTAAAAGCCCTGGAAAGCGGGACGC
TTGTGTGGCTGGAAGTTGCGTTTCCGGCCCGCTTTACCGAAGAGGTGCTGGAGAAAGTATCGGTAGAATT
GAATGCCTTTCCTGTACTGAACCGGAAACTAAATCGGATTCTTTACCGGACGATGGCCAATTTCAACCTG
CTGCCTCTCCGAACCGACCCCTTCGAAACGCTGCTGATGGTTAAGGCCGTGGTTGATAGTAAGGATCGAG
TCTTCATTCCTCACCCGTTTCATAAGGCAGAAGATATCAGCTCGGGCGGATATGCGGTTCGTCGGGGGGG
CGTGGAGCGCTTCGATGTGCGTAACGCCCGCGAGCAGCTGACATTTCTGCTGGAGTTGCTGCGGGATGAG
TCGGTTGCTTTTGCGGTGTATGGGCAAGACACCATTCGGTTGCTGCTCACACAGCTTCAGGACCAGATCG
AGCGGCTTGAACGCAAAATTCAGAACACAAACATGCCGCCCCTGACCATCAATCAATACGTTACGTTCAA
GCCTTTCGAAGCGGGTGATTCGATGCAGGTCGACTTCTGGACAACTACCTGCGAGTTGGCCAATAACATT
CCGGCAGGGACCTACTTACAGGCCTACAATACCAATAGCCTGGCAGGCGACAGCATTAAGCTGCTGACCG
GCACGACCGGCGGTCGCAGTCGGCCGTCGGCATTGCACCGGGTTCAAACGTACCGATACGCGCTCATGAC
GCACCAGCGAATCATCACTCAGGAGGATGTACGGGCCTTTTTTTACCACGAACTGGGGCCTTTGCTGAAA
TCGGTAACGATTCGGAAAGGCGTTGCCATTGGCAAAACAGTAAAAGAAGGATTAATGCGCACCGTTGATA
TTATCGTAAAACCGGCTGAGGATTGTACCTTAACTGAATCGGAGTGGAAAGTCGTGCTTGAGAGCGTTCA
TCAGAAATTGATTCAACGTTCGGGTCAGGTCACTACGTACCGACTATTTTTAGATGAAGTGCTGCTACCT
GTTTAA