SecReT6
Protein ID: 284038964
SecReT6 ID914
T6SS typeiii
Gene symbol-
Locus tagSlin_4108
StrainSpirosoma linguale DSM 74
Repliconchromosome [GenBank: NC_013730] [Browse all T6SS(s) in this replicon]
Location [Strand]4946495..4946929 [-]
ProductGPW/gp25 family protein
NoteTssE
UniProt IDD2QJP9
KEGG IDsli:Slin_4108
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 4.70E-13, Aligned region: 28..129
Protein Sequence: 144 a.a.     [Download]
>gi|284038964|ref|YP_003388894.1| GPW/gp25 family protein [Spirosoma linguale DSM 74]
MNQVFYRHPIRFGPIMVGQEMPTCGVGTSIAQVLYLLLHTRYGELRSDRSFGCKIWDFDYDRTVSNTYWV
TQLCESLEAAIQRHERRLTKPQVSVQFQPVEHRLDALPEDYQQLATVTISATLVETEEPFRFTTQLHLGH
LSTR
 
Nucleotide Sequence: 435 bp     [Download]
>gi|284034943|ref|NC_013730.1|:c4946929-4946495 Spirosoma linguale DSM 74 chromosome, complete genome
ATGAATCAGGTATTTTATCGCCATCCAATTCGCTTTGGCCCGATCATGGTCGGGCAGGAAATGCCGACCT
GCGGTGTAGGTACTTCAATTGCTCAGGTGCTCTATTTACTGCTGCACACCCGCTATGGAGAGTTGCGAAG
TGACCGCTCGTTCGGCTGTAAAATCTGGGATTTCGACTACGACCGTACGGTTAGCAATACCTACTGGGTT
ACGCAGTTGTGTGAGTCGCTGGAAGCCGCCATTCAGCGTCATGAACGACGGTTGACGAAGCCACAGGTGA
GTGTGCAGTTCCAGCCGGTAGAACATCGGCTGGATGCGCTTCCTGAAGATTATCAGCAGTTGGCGACGGT
GACAATAAGCGCCACCCTGGTCGAAACAGAAGAGCCATTCCGGTTTACAACCCAATTGCACCTGGGTCAT
CTGTCGACTCGCTGA