SecReT6
Protein ID: 284038968
SecReT6 ID914
T6SS typeiii
Gene symbol-
Locus tagSlin_4112
StrainSpirosoma linguale DSM 74
Repliconchromosome [GenBank: NC_013730] [Browse all T6SS(s) in this replicon]
Location [Strand]4953087..4954241 [-]
Producthypothetical protein
NoteTssK
UniProt IDD2QJQ3
KEGG IDsli:Slin_4112
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 384 a.a.     [Download]
>gi|284038968|ref|YP_003388898.1| hypothetical protein Slin_4112 [Spirosoma linguale DSM 74]
MLFPKNHLPVNWVDGMKLSQQHFVDTDHQIQDLVRDSVSLFLTSYNYGLLPPVRGTSVAHEFDLLEKNGN
YVEVRLFRCNAITQGGCRIAINPDVLKFTVLTASFAITQQTESQQPVGYDIVLAVNPFEKVPVGNPNPEE
SPLRHPYTEYGYELMVVASQHVNADELGQHHLIIGKAIYHEGHYIIDSQYIPPCASISSHPRLIQYYKNF
GWGLNEIQVSSFKIIRKVFEQQQPSDIARHVQHLCNRVLDYLGTVFFDYRNMDHQHPPVVLVGYFANLTS
IIYTGLYCMPSRQKEELLHYFFEWTNVTPGQFEELLLRLLEHDYNHNQIGVAMNAIEQFLSVFTKLWNKL
STLEYIGQRKETILVHEEAPIQIAPSRRGWNILD
 
Nucleotide Sequence: 1155 bp     [Download]
>gi|284034943|ref|NC_013730.1|:c4954241-4953087 Spirosoma linguale DSM 74 chromosome, complete genome
ATGTTATTCCCTAAAAATCACCTGCCGGTAAACTGGGTCGATGGCATGAAGCTGTCGCAGCAGCATTTTG
TTGACACCGATCATCAGATTCAGGATTTGGTCCGCGATTCGGTATCGCTGTTCCTGACCAGCTACAACTA
CGGTTTATTACCACCGGTGCGCGGCACGTCGGTAGCCCATGAGTTCGACCTGCTCGAAAAAAACGGCAAT
TATGTCGAAGTCCGTCTGTTTCGCTGCAACGCCATCACGCAGGGTGGCTGTCGTATCGCCATTAATCCGG
ATGTGCTGAAATTTACGGTGTTGACGGCTTCGTTTGCCATTACTCAACAAACGGAAAGCCAGCAGCCCGT
TGGGTATGATATTGTGCTGGCCGTAAATCCGTTCGAGAAAGTGCCAGTCGGCAATCCCAATCCCGAAGAG
TCACCGCTACGGCATCCCTATACCGAATATGGCTATGAGTTGATGGTCGTTGCCTCTCAGCACGTCAATG
CGGATGAGTTGGGCCAGCACCACCTGATTATCGGGAAAGCGATCTATCACGAAGGGCATTACATTATCGA
CAGCCAGTACATTCCGCCCTGTGCGTCAATTTCCAGCCATCCGCGCCTGATTCAGTATTACAAAAACTTT
GGCTGGGGGCTGAACGAGATTCAGGTGAGTTCGTTCAAGATCATCCGCAAGGTTTTCGAGCAGCAGCAGC
CATCCGATATTGCCCGTCATGTTCAGCATCTGTGCAACCGGGTACTGGATTATTTAGGAACTGTCTTTTT
CGATTACCGCAACATGGACCATCAGCACCCGCCGGTGGTTCTGGTGGGCTACTTTGCCAATCTGACGAGT
ATTATCTATACCGGATTGTACTGTATGCCAAGTCGGCAGAAAGAAGAACTGCTGCATTATTTCTTCGAAT
GGACAAACGTAACGCCGGGCCAGTTCGAAGAACTCCTGTTGCGCTTGCTTGAACACGATTACAACCACAA
CCAGATTGGGGTTGCCATGAACGCCATCGAGCAATTTCTGAGCGTTTTCACCAAACTCTGGAATAAGCTC
AGTACACTTGAATATATCGGCCAGCGGAAAGAAACGATTCTGGTGCATGAGGAGGCTCCCATCCAGATCG
CACCCAGCCGGCGGGGCTGGAATATTCTGGACTGA