SecReT6
Protein ID: 284038969
SecReT6 ID914
T6SS typeiii
Gene symbol-
Locus tagSlin_4113
StrainSpirosoma linguale DSM 74
Repliconchromosome [GenBank: NC_013730] [Browse all T6SS(s) in this replicon]
Location [Strand]4954248..4955126 [-]
Producthypothetical protein
NoteTssN
UniProt IDD2QJQ4
KEGG IDsli:Slin_4113
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 292 a.a.     [Download]
>gi|284038969|ref|YP_003388899.1| hypothetical protein Slin_4113 [Spirosoma linguale DSM 74]
MNVTSPFIINYIILLLIAVGMTAWAIWINRQNELMANRRLLLTILIGALILTLPSLFGLIGLDFIPVGYI
VVQVVSLVLGVLFLSRMLVDMGPAFVTKPAFIILLAGSIICFGAALFTPVFHYLSSFLYGVVPYDLWAAT
SLLPFILPILFAYTFNALVAVPSEIYKLWYYPRNAEEVDMDEVDYFRLTLLEVQIHKHPGRKEPPIKVKA
RSTGNMAFGTWFQKLIDDYNIKFPNDPIKTFDESAHEYGWSFYSIKPSLFRLRNYIDFEKTIAENNLSEN
HLIVAKRVEEFA
 
Nucleotide Sequence: 879 bp     [Download]
>gi|284034943|ref|NC_013730.1|:c4955126-4954248 Spirosoma linguale DSM 74 chromosome, complete genome
ATGAACGTCACATCGCCTTTTATCATCAATTACATTATCTTATTGCTTATCGCTGTAGGCATGACTGCCT
GGGCCATATGGATTAACCGGCAGAACGAGTTGATGGCGAACCGACGGCTGCTGTTAACGATCCTGATCGG
CGCTTTAATTCTCACGCTCCCCAGTTTATTTGGGCTGATTGGCCTGGATTTTATTCCGGTAGGCTACATC
GTGGTGCAGGTGGTCAGCCTTGTACTGGGCGTTCTTTTTTTGAGCCGGATGCTGGTCGATATGGGACCGG
CCTTTGTTACAAAACCAGCTTTTATCATTCTGCTGGCGGGTAGTATCATCTGTTTCGGTGCTGCGCTGTT
TACTCCAGTATTTCATTATCTAAGCAGCTTTTTATACGGTGTTGTTCCCTATGATCTCTGGGCCGCAACC
AGCCTGCTTCCGTTTATCCTGCCTATCCTGTTCGCGTACACGTTTAATGCGCTGGTAGCCGTTCCCAGCG
AGATTTATAAACTTTGGTATTACCCGCGAAATGCGGAAGAAGTGGACATGGACGAAGTCGATTATTTTCG
GCTTACCCTGCTGGAGGTTCAGATTCATAAACACCCCGGCCGGAAGGAGCCACCCATTAAAGTTAAGGCC
CGCTCAACGGGTAATATGGCTTTCGGGACGTGGTTTCAGAAACTTATCGACGATTACAATATCAAATTTC
CCAACGACCCGATCAAAACGTTCGATGAGTCGGCTCATGAGTATGGCTGGTCGTTTTACAGTATCAAGCC
GTCCCTTTTCCGGTTGCGGAATTATATTGATTTTGAAAAAACAATAGCCGAGAATAACCTTAGCGAAAAC
CACCTGATTGTGGCCAAGCGGGTGGAAGAATTTGCCTAA