SecReT6
Protein ID: 284038974
SecReT6 ID914
T6SS typeiii
Gene symbol-
Locus tagSlin_4118
StrainSpirosoma linguale DSM 74
Repliconchromosome [GenBank: NC_013730] [Browse all T6SS(s) in this replicon]
Location [Strand]4964834..4965232 [+]
Producthypothetical protein
NoteHcp
UniProt IDD2QJQ9
KEGG IDsli:Slin_4118
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 1.30E-05, Aligned region: 13..120
Protein Sequence: 132 a.a.     [Download]
>gi|284038974|ref|YP_003388904.1| hypothetical protein Slin_4118 [Spirosoma linguale DSM 74]
MPYSSKLTLGAEKYDILGGDIGFTRSVDLKGRPSSHVMGGQFSFTIEVTDKSTLVEQMVNSQNKPFDKGS
LEFTDAGDDGVTRKIEFENAYIVNYSESFSVAGAAYTCSLTLSAEKITIQTAVLDQRWPVKK
 
Nucleotide Sequence: 399 bp     [Download]
>gi|284034943|ref|NC_013730.1|:4964834-4965232 Spirosoma linguale DSM 74 chromosome, complete genome
ATGCCATATTCAAGTAAACTTACACTTGGCGCCGAGAAGTACGACATCTTGGGGGGCGACATTGGCTTTA
CCAGGTCCGTTGACCTCAAAGGAAGGCCTTCCAGCCACGTCATGGGCGGCCAGTTCTCCTTTACCATTGA
AGTGACGGATAAGTCGACATTGGTTGAGCAAATGGTTAATTCGCAGAACAAGCCCTTTGATAAAGGTTCA
TTAGAATTTACGGATGCCGGTGATGATGGCGTGACTCGCAAAATTGAGTTTGAGAATGCCTATATCGTCA
ACTACAGTGAATCGTTCTCAGTGGCAGGTGCCGCGTATACCTGTTCGCTCACCTTGTCAGCGGAGAAAAT
CACGATCCAGACAGCAGTACTGGATCAACGGTGGCCCGTTAAGAAATAA