SecReT6
Protein ID: 284038975
SecReT6 ID914
T6SS typeiii
Gene symbol-
Locus tagSlin_4119
StrainSpirosoma linguale DSM 74
Repliconchromosome [GenBank: NC_013730] [Browse all T6SS(s) in this replicon]
Location [Strand]4965261..4965677 [+]
Producthypothetical protein
NoteHcp
UniProt IDD2QJR0
KEGG IDsli:Slin_4119
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 138 a.a.     [Download]
>gi|284038975|ref|YP_003388905.1| hypothetical protein Slin_4119 [Spirosoma linguale DSM 74]
MAEQANVGFTATLTIGADKFDILSFGTSFSRDFDQKGRPSSAVRAGDMSFTIEITQNEKLVDMMINAQNK
AIDGKAEFWQSGKDAIFRTVDFKNGYITSYKEGFQPAGSSNFAADISITAEKITVGAAVYDAEWPLNS
 
Nucleotide Sequence: 417 bp     [Download]
>gi|284034943|ref|NC_013730.1|:4965261-4965677 Spirosoma linguale DSM 74 chromosome, complete genome
ATGGCAGAACAAGCAAATGTAGGCTTTACAGCAACACTAACTATCGGGGCTGATAAATTTGATATTCTTA
GCTTCGGAACCTCTTTCAGCCGGGATTTTGACCAGAAAGGACGCCCTTCGTCGGCGGTTCGGGCAGGTGA
TATGTCGTTTACCATTGAGATAACTCAGAACGAAAAACTGGTCGATATGATGATTAACGCCCAGAATAAG
GCAATCGACGGAAAAGCGGAATTCTGGCAATCCGGTAAAGATGCTATCTTCCGTACGGTCGATTTCAAAA
ATGGCTATATCACAAGCTACAAAGAAGGCTTTCAACCGGCGGGGTCCAGCAACTTCGCTGCCGATATTTC
CATCACGGCGGAGAAAATAACCGTTGGTGCCGCCGTTTACGACGCGGAATGGCCACTGAACAGTTAA