SecReT6
Protein ID: 28869731
SecReT6 ID41
T6SS typei1
Gene symbol-
Locus tagPSPTO_2538
StrainPseudomonas syringae pv. tomato str. DC3000
Repliconchromosome [GenBank: NC_004578] [Browse all T6SS(s) in this replicon]
Location [Strand]2801756..2803798 [-]
ProductRhs element Vgr protein
NoteTssI
UniProt IDQ882T4
KEGG IDpst:PSPTO_2538
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 5.80E-73, Aligned region: 30..323
Phage_GPD [PF05954], Evalue: 5.80E-73, Aligned region: 511..582
Phage_base_V [PF04717], Evalue: 9.30E-25, Aligned region: 370..463
DUF2345 [PF10106], Evalue: 2.20E-05, Aligned region: 568..616
Protein Sequence: 680 a.a.     [Download]
>gi|28869731|ref|NP_792350.1| unnamed protein product [Pseudomonas syringae pv. tomato str. DC3000]
MQSEIISLPHFSLSLSDAHHDFQVFAFTGHEAISQPFCFKLDLVSEHTSLDLESLLGRSAFLKFAPDGGG
IHGLIDQIAQGESGRRLTHYSITLRPHLARLEHRTDQRIFQDLTVPQIIEQVLEKHGLLATTFNFHLGTN
YPKRDYCVQYGESDLHFIQRLCEEEGLHYHFEHSATAHQLVFGDDQTVFPELGPVIYRQDTALAGTKPAI
QHYRLRLETRPNSHHSRDYHFEKPLLITKGSANVSRRIELQEYDYPGGFTSRDRGDHLAQRALERLNHDY
LSGEGRSNQARLVSGHFLRLSEHPNKEWNDLWLLTGVRHEGRQPRVLEESACEIQNPGDFHQGYRNTFTT
TPWYALYRSPLRHPKRRIFGSQTAVVTGPKGEEIHCDKHGRVKVQFHWDRDAEADDRSSCWLRVSSSWAG
NRYGGMTIPRVGMEVLVTFLEGDPDRPLVSGCLYHAEHVPPYDLPAHQTRSVFKTLSSPGGGGSNELRIE
DRAGQEQIYAHAQRNWDQNIKHDQKIRIGHERHDRVEANSYSEFKAQEHRLVDGDRLTEAKADDHLRVGG
TRHLKLGNALLAEAGQEIHLKSADKIVLEAGMELTFKVAGSFIKIDASGVTVGGPAIHLNSGGSPGSGSG
ATPLLPGPTLRADTTKPGEVLAHAQRRAMRRTPRCEVCEQQAAKKRSRNG
 
Nucleotide Sequence: 2043 bp     [Download]
>gi|28867243|ref|NC_004578.1|:c2803798-2801756 Pseudomonas syringae pv. tomato str. DC3000 chromosome, complete genome
ATGCAGTCCGAAATAATCTCGCTCCCCCACTTCAGTCTGAGCCTTTCTGACGCCCACCATGACTTTCAAG
TCTTCGCCTTCACCGGTCACGAAGCCATCAGCCAGCCCTTCTGCTTCAAGCTGGATCTGGTCAGCGAGCA
CACTTCGCTGGATCTTGAAAGTTTGCTGGGGCGCTCAGCGTTCCTAAAGTTTGCACCCGACGGCGGTGGA
ATCCATGGCCTGATCGATCAGATTGCCCAAGGCGAATCCGGTCGACGTTTGACTCACTATTCGATCACGT
TGCGCCCGCACCTGGCCCGGCTTGAGCATCGTACTGATCAGCGTATTTTTCAGGACCTGACGGTGCCCCA
GATCATTGAACAGGTACTTGAAAAGCACGGCCTGCTGGCCACCACGTTCAATTTTCATCTAGGAACGAAC
TACCCGAAACGCGATTACTGCGTGCAATACGGCGAGTCTGACTTGCACTTCATTCAGCGGCTGTGCGAAG
AAGAAGGCCTGCACTACCACTTCGAGCACAGCGCTACCGCCCATCAACTGGTGTTTGGTGACGACCAGAC
AGTGTTCCCGGAACTGGGCCCGGTTATCTACAGACAGGACACCGCCCTGGCGGGCACAAAGCCGGCCATC
CAGCACTACAGACTGCGCCTGGAGACGCGCCCCAACAGTCACCATAGCCGCGATTACCATTTCGAGAAGC
CGCTGCTGATCACCAAGGGATCGGCCAATGTCAGTCGTCGTATCGAGCTCCAGGAATACGACTACCCGGG
CGGCTTCACCAGCCGTGATCGTGGCGATCATCTTGCACAACGCGCGCTGGAGCGCCTCAATCACGATTAC
CTGTCAGGTGAAGGTCGCAGTAACCAGGCTCGGCTCGTCAGTGGCCATTTTCTGAGGCTGAGCGAACATC
CCAACAAGGAATGGAATGATCTGTGGCTGCTGACCGGCGTTCGTCATGAAGGCCGTCAGCCGCGGGTACT
TGAGGAGTCCGCATGTGAAATTCAGAACCCCGGCGACTTTCATCAGGGCTACCGCAATACGTTCACTACC
ACGCCTTGGTACGCCTTGTACCGCTCGCCCCTGCGTCATCCCAAACGAAGAATCTTCGGCAGTCAGACCG
CCGTGGTCACAGGCCCGAAAGGTGAGGAAATCCACTGCGACAAACACGGTCGGGTCAAAGTGCAGTTCCA
CTGGGATCGCGACGCTGAGGCCGATGACCGGAGCAGTTGCTGGTTGCGCGTGTCATCCAGTTGGGCGGGC
AATCGTTATGGCGGCATGACCATCCCGCGTGTCGGTATGGAAGTGCTGGTAACGTTTCTTGAGGGCGACC
CCGACCGGCCACTGGTCAGTGGCTGCCTGTACCACGCCGAGCACGTACCGCCTTATGACCTGCCCGCCCA
CCAGACGCGCAGCGTATTCAAGACCTTGAGTAGTCCAGGCGGAGGTGGCTCAAACGAGCTGCGTATCGAA
GACAGGGCCGGCCAGGAGCAAATCTATGCTCACGCCCAGCGCAATTGGGACCAAAACATCAAACATGATC
AAAAGATCCGAATTGGTCATGAGCGTCATGACCGCGTGGAAGCAAACAGCTACAGCGAGTTCAAGGCTCA
GGAACACCGTCTGGTTGATGGCGACCGGCTGACTGAAGCCAAAGCGGACGACCATCTGAGGGTAGGTGGG
ACTCGGCACCTGAAACTGGGTAATGCACTGCTGGCAGAGGCTGGGCAGGAAATCCATTTGAAGAGTGCCG
ACAAGATTGTTCTGGAGGCTGGCATGGAGCTGACATTCAAAGTGGCTGGCAGCTTCATAAAGATTGACGC
AAGCGGCGTGACGGTGGGAGGGCCTGCCATCCATTTGAACTCCGGGGGAAGCCCGGGCAGTGGCTCCGGC
GCAACCCCCTTGCTGCCGGGTCCGACACTGCGAGCTGATACGACCAAGCCTGGGGAGGTTCTTGCACATG
CCCAGAGGCGGGCCATGAGGCGCACGCCACGTTGTGAGGTTTGCGAACAACAGGCTGCGAAAAAGAGGTC
GCGCAATGGATAA