SecReT6
Protein ID: 28869732
SecReT6 ID41
T6SS typei1
Gene symbolhcp-1
Locus tagPSPTO_2539
StrainPseudomonas syringae pv. tomato str. DC3000
Repliconchromosome [GenBank: NC_004578] [Browse all T6SS(s) in this replicon]
Location [Strand]2803874..2804389 [-]
Productsecreted protein Hcp
NoteTssD
UniProt IDQ882T3
KEGG IDpst:PSPTO_2539
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 3.10E-32, Aligned region: 18..154
Protein Sequence: 171 a.a.     [Download]
>gi|28869732|ref|NP_792351.1| hcp-1 gene product [Pseudomonas syringae pv. tomato str. DC3000]
MPTPAFLSVTGTKQGHITEQAGSIDSLGGHGQIDHPDESIVHAFSHEIISPYDAQSGEITGRRRHNAICI
TKVFDRASPLLLEALCRGEKLTDVVINWYRTNDGKEQNYYRTTLHGALIVAIKDHMPTCDDPNNSHAIHL
QDVHFTYRQIRWDHVIATSSGSYDLDDLGLD
 
Nucleotide Sequence: 516 bp     [Download]
>gi|28867243|ref|NC_004578.1|:c2804389-2803874 Pseudomonas syringae pv. tomato str. DC3000 chromosome, complete genome
ATGCCTACACCCGCATTTCTATCTGTCACAGGGACCAAACAAGGTCATATTACAGAACAGGCTGGTTCCA
TTGACTCTTTAGGCGGCCATGGCCAGATAGATCATCCTGACGAATCAATTGTTCACGCATTCAGTCACGA
AATCATATCCCCTTACGACGCTCAGTCAGGCGAAATTACTGGTCGACGCAGGCATAACGCAATTTGTATC
ACAAAAGTATTTGACCGGGCATCGCCATTACTTCTGGAAGCGTTATGCAGGGGCGAAAAACTAACTGACG
TTGTGATAAATTGGTACCGCACTAACGACGGCAAGGAGCAAAACTACTATAGAACAACACTTCATGGGGC
GCTTATTGTGGCTATAAAAGACCACATGCCAACCTGCGACGATCCAAATAACTCGCATGCCATCCATCTG
CAGGATGTGCACTTTACCTACCGTCAAATAAGATGGGATCACGTGATAGCTACTTCATCCGGATCATACG
ACCTGGACGACTTAGGTCTGGACTGA