SecReT6
Protein ID: 28869734
SecReT6 ID41
T6SS typei1
Gene symbol-
Locus tagPSPTO_2543
StrainPseudomonas syringae pv. tomato str. DC3000
Repliconchromosome [GenBank: NC_004578] [Browse all T6SS(s) in this replicon]
Location [Strand]2807665..2808165 [+]
Producthypothetical protein
NoteTssB
UniProt IDQ882T2
KEGG IDpst:PSPTO_2543
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 2.30E-53, Aligned region: 5..159
Protein Sequence: 166 a.a.     [Download]
>gi|28869734|ref|NP_792353.1| unnamed protein product [Pseudomonas syringae pv. tomato str. DC3000]
MAREGSVAPKERINVTFKPAIGSAQEEIELPLKLLVLGDFTQRFDERKLEDRKSISIDKNNFDDFMAKQE
LELALIVPNRLQADSEVDDLTVSIKVASMKDFNPASLVEQIPELKKLMELRNALMSLKGPLGNTPAFRKA
IEKVISDNESRGKVLDELGLGVVAQQ
 
Nucleotide Sequence: 501 bp     [Download]
>gi|28867243|ref|NC_004578.1|:2807665-2808165 Pseudomonas syringae pv. tomato str. DC3000 chromosome, complete genome
ATGGCCAGAGAAGGCTCTGTTGCGCCCAAAGAACGGATCAACGTCACATTCAAACCAGCCATCGGGAGCG
CGCAGGAAGAAATAGAGCTACCGCTGAAACTTCTGGTTCTCGGCGACTTTACACAGCGGTTCGATGAACG
AAAGCTCGAAGACCGTAAGTCGATCAGCATCGACAAGAATAATTTCGATGACTTCATGGCCAAGCAAGAG
CTGGAACTTGCGTTGATCGTGCCTAATCGTTTGCAGGCTGACAGTGAGGTTGATGACTTGACTGTCAGCA
TTAAAGTGGCCTCGATGAAAGATTTCAACCCAGCCAGCCTCGTGGAGCAAATTCCCGAACTGAAAAAACT
GATGGAACTTCGTAATGCGTTGATGTCGTTAAAAGGACCCTTGGGTAATACGCCTGCTTTTCGCAAGGCT
ATCGAGAAGGTCATTTCTGACAATGAATCACGTGGGAAGGTGCTAGACGAGCTCGGCCTCGGTGTAGTAG
CGCAGCAGTGA