SecReT6
Protein ID: 28869735
SecReT6 ID41
T6SS typei1
Gene symbol-
Locus tagPSPTO_2544
StrainPseudomonas syringae pv. tomato str. DC3000
Repliconchromosome [GenBank: NC_004578] [Browse all T6SS(s) in this replicon]
Location [Strand]2808195..2809670 [+]
Producthypothetical protein
NoteTssC
UniProt IDQ882T1
KEGG IDpst:PSPTO_2544
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 5.70E-189, Aligned region: 64..488
Protein Sequence: 491 a.a.     [Download]
>gi|28869735|ref|NP_792354.1| unnamed protein product [Pseudomonas syringae pv. tomato str. DC3000]
MTSKAMQQGTVSEFQHGILDQIIAETRLSPDDDAYEIAKRGVAAFIEELLKPHNSNEPVKKALVDRMITE
IDAKLSQQMDEIIHHAEFQALEASWRGLQLLIDRTDFRENIKIELLSISRQDLLEDFEDSPEVVQSGLYK
HVYTAEYGQFGGNPVGAIIANYFFSPSAPDVKTMQYVSSVACMAHAPFIAAAGPNFFGLEQFTGLPDLKD
LRDHFEGPQFAKWQSFRQQEDARYLALTVPRFLLRSPYEPEENPVKTFAYKENVANSHEHYLWGNTAYAF
ATKLTDSFAKFRWCPNIIGPLSGGAVEDLPLHHFHSMGEIETKIPTEVLVSDRREYELAEEGFIALTMRK
GSDNAAFFSASSVQKPKFFGNSPEGKTAELNYRLGTQLPYMMVVNRLAHYLKVLQREQIGSWKERADLEA
QLNKWIRQYIADQENPSSEVRGRRPLRSAQIIVSDVEGDPGWYRVSLNVRPHFKYMGADFTLSLVGKMDK
E
 
Nucleotide Sequence: 1476 bp     [Download]
>gi|28867243|ref|NC_004578.1|:2808195-2809670 Pseudomonas syringae pv. tomato str. DC3000 chromosome, complete genome
ATGACCAGCAAAGCTATGCAACAGGGTACTGTCAGCGAATTTCAGCACGGAATCCTTGATCAGATCATCG
CAGAAACCAGGCTGAGCCCGGATGATGATGCCTATGAAATTGCCAAGCGTGGTGTTGCTGCGTTTATCGA
AGAACTGCTCAAGCCGCACAACAGCAACGAGCCAGTAAAAAAGGCCTTGGTCGATCGAATGATCACGGAA
ATTGACGCCAAACTGAGTCAGCAGATGGATGAGATCATTCACCATGCAGAATTTCAGGCATTGGAGGCGT
CCTGGCGCGGACTGCAGTTACTGATTGATCGAACAGATTTTCGCGAAAATATCAAAATCGAATTGTTGAG
CATCTCCAGGCAGGACCTTCTGGAGGATTTTGAGGACTCCCCCGAAGTGGTCCAGTCGGGACTTTACAAG
CACGTCTACACCGCTGAATACGGCCAGTTTGGTGGCAATCCGGTTGGTGCAATCATTGCCAACTATTTCT
TTTCCCCAAGCGCTCCCGATGTCAAGACCATGCAGTACGTTTCAAGTGTTGCCTGTATGGCACACGCACC
ATTTATCGCGGCGGCGGGGCCCAATTTTTTCGGGCTTGAGCAGTTCACCGGTCTGCCTGACCTCAAAGAC
TTGAGAGATCATTTCGAAGGCCCACAGTTCGCCAAATGGCAGAGCTTCCGCCAGCAAGAAGACGCTCGAT
ACCTGGCACTGACAGTGCCACGTTTTCTTTTGCGCAGCCCTTACGAGCCCGAGGAAAATCCGGTTAAAAC
GTTTGCCTACAAGGAGAATGTTGCGAACAGTCACGAGCACTATCTGTGGGGGAACACGGCGTATGCATTC
GCGACGAAGCTGACAGACAGCTTCGCCAAATTCCGCTGGTGTCCTAACATCATCGGGCCGTTGAGCGGCG
GTGCCGTCGAAGATCTTCCTTTGCATCACTTCCACAGCATGGGCGAGATCGAGACCAAGATCCCGACTGA
AGTGCTGGTCTCTGATCGTCGTGAGTACGAGCTGGCCGAGGAAGGGTTCATTGCATTGACCATGCGCAAA
GGAAGCGACAACGCCGCCTTTTTCTCGGCGAGCTCAGTGCAGAAGCCGAAGTTTTTCGGCAACAGCCCGG
AAGGTAAGACAGCCGAACTCAATTACAGGCTGGGTACTCAACTGCCGTACATGATGGTGGTCAACCGACT
GGCGCATTATCTCAAGGTCTTGCAGCGGGAACAGATAGGCTCCTGGAAAGAACGAGCGGATCTCGAGGCT
CAACTCAATAAATGGATTCGCCAGTATATTGCAGACCAGGAAAATCCAAGTTCTGAAGTACGTGGACGGC
GTCCGTTACGCTCTGCGCAAATCATCGTCAGTGACGTGGAAGGTGATCCTGGCTGGTACCGGGTCAGTTT
GAATGTTCGTCCTCATTTTAAATACATGGGCGCTGATTTCACCTTGTCTCTGGTCGGCAAGATGGACAAG
GAATAG