SecReT6
Protein ID: 28869736
SecReT6 ID41
T6SS typei1
Gene symbol-
Locus tagPSPTO_2545
StrainPseudomonas syringae pv. tomato str. DC3000
Repliconchromosome [GenBank: NC_004578] [Browse all T6SS(s) in this replicon]
Location [Strand]2809686..2810093 [+]
Producthypothetical protein
NoteTssE
UniProt IDQ882T0
KEGG IDpst:PSPTO_2545
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 7.70E-19, Aligned region: 26..117
Protein Sequence: 135 a.a.     [Download]
>gi|28869736|ref|NP_792355.1| unnamed protein product [Pseudomonas syringae pv. tomato str. DC3000]
MNFNGSLFERLADKTQKKTDLNEEERITASIATHLAKLLGTRAGSVNTLPDYGLPELNNASLSAHDTVRQ
SRLAIEKAIRDYEPRLSEVHVMSDESSWCVLKRTFSIDASLDMNGVKKTVVFSIAVAGDGHVILN
 
Nucleotide Sequence: 408 bp     [Download]
>gi|28867243|ref|NC_004578.1|:2809686-2810093 Pseudomonas syringae pv. tomato str. DC3000 chromosome, complete genome
ATGAACTTCAACGGTAGCCTTTTCGAGCGGCTTGCCGACAAGACGCAAAAAAAAACCGACCTCAACGAAG
AGGAGCGCATAACAGCGTCAATAGCGACGCATCTGGCGAAGCTGCTCGGTACTCGTGCCGGGAGCGTGAA
CACACTACCGGATTATGGTCTGCCTGAGCTTAATAACGCGAGTCTGAGTGCCCATGACACGGTGAGGCAG
TCTCGGCTGGCTATAGAGAAAGCCATTCGTGATTATGAACCGCGCTTGTCTGAAGTTCATGTGATGTCTG
ATGAAAGCTCATGGTGTGTACTCAAACGAACATTTTCTATTGACGCGTCCCTCGATATGAACGGCGTCAA
GAAAACAGTTGTTTTTTCTATAGCCGTAGCGGGGGACGGGCACGTAATTCTCAATTGA