SecReT6
Protein ID: 28869737
SecReT6 ID41
T6SS typei1
Gene symbol-
Locus tagPSPTO_2546
StrainPseudomonas syringae pv. tomato str. DC3000
Repliconchromosome [GenBank: NC_004578] [Browse all T6SS(s) in this replicon]
Location [Strand]2810191..2811978 [+]
Producthypothetical protein
NoteTssF
UniProt IDQ882S9
KEGG IDpst:PSPTO_2546
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 6.50E-183, Aligned region: 3..595
Protein Sequence: 595 a.a.     [Download]
>gi|28869737|ref|NP_792356.1| unnamed protein product [Pseudomonas syringae pv. tomato str. DC3000]
MSFNHYYQDELMALRQMGVKFSERNPALAPFLGQVGLDPDVERLLEGFAFLTGRLRQKLDDDLPELTHSL
MQLLWPNYMRPLPAVSMLQFEALTCPAIGVTVERETPVESEPVNGMVCHFRTCFATRVLPLKLVSLSCSA
GGAGTVLKLRLDINGDGHVGNLEFSQLRLHFAGERHISQALYLGMMRQLNAIKLSPLDAQGALIMTAEGK
AIELAIPVDQVKPVGFAEEESLIPYPLNTFRGYRYLQEYFFFPEKFLFVDVFGVDVLRSLDEDVLKNTRG
VQLVFDMESAEIQGLRPGVENVKLYCTPVVNLFKQDALPILADSRQDEYLLVPAHYARGSCGVYSVDKVT
GWQPGGLGYQHYVPFESFEHDSAVSVKSDSPYYSVRHRASLQHSGLDTFLSFDLRAERARETVSIELTCT
NDELPQKISVGGICKSCDGTPDFLRFKNIMPATRSFAPPMTRDFLWRVISNMSLNYLSLANIEALKVILE
TYDLPRYYDPRAEKVSQHLLKGLKSIRHQPVDRLHNGRPVRGVKTELTVQPDGFTGEGSLFLFASVLNEF
FALYASLNSFHELHVTSTQGGGYQWKPRMGQQPLL
 
Nucleotide Sequence: 1788 bp     [Download]
>gi|28867243|ref|NC_004578.1|:2810191-2811978 Pseudomonas syringae pv. tomato str. DC3000 chromosome, complete genome
TTGTCATTTAATCACTATTATCAAGACGAGCTGATGGCTCTCCGCCAAATGGGGGTTAAGTTCTCTGAGC
GTAACCCCGCGCTGGCGCCTTTCCTGGGGCAAGTAGGTCTGGATCCAGACGTCGAGCGATTACTGGAAGG
GTTCGCGTTCCTGACCGGTCGTTTACGTCAGAAGCTGGACGATGACCTGCCTGAGTTGACCCACTCGCTC
ATGCAGTTGTTATGGCCCAACTACATGCGGCCGCTGCCCGCGGTGAGCATGCTTCAGTTTGAAGCGCTGA
CCTGCCCGGCAATTGGTGTGACCGTTGAGCGAGAAACGCCGGTAGAAAGTGAACCCGTCAACGGCATGGT
GTGCCATTTCCGTACGTGTTTCGCCACCCGTGTCCTGCCGCTGAAACTGGTGAGTTTGTCCTGCTCGGCA
GGCGGGGCGGGTACGGTGCTGAAGTTGCGTCTGGACATAAATGGAGACGGGCACGTTGGCAATCTGGAGT
TCAGCCAGTTGCGTTTGCACTTCGCGGGCGAGCGCCATATCAGCCAGGCACTCTATCTGGGGATGATGCG
TCAACTTAACGCTATCAAATTATCACCCCTGGATGCGCAGGGCGCCTTGATTATGACGGCCGAGGGAAAG
GCGATTGAGCTGGCTATTCCTGTTGATCAAGTAAAGCCTGTCGGGTTTGCGGAAGAAGAGTCGTTGATTC
CCTATCCACTGAACACCTTTCGCGGCTATCGCTATCTGCAAGAGTATTTCTTCTTTCCGGAGAAATTCCT
TTTCGTCGATGTTTTCGGCGTCGACGTACTTCGTTCGCTGGATGAGGATGTATTGAAGAACACCCGCGGT
GTACAGCTGGTTTTTGATATGGAAAGCGCTGAGATACAAGGGCTTCGTCCAGGTGTCGAAAACGTGAAAC
TGTATTGCACGCCTGTCGTGAATTTGTTCAAGCAAGACGCGCTGCCTATTCTTGCGGACTCAAGGCAGGA
CGAGTATCTGCTGGTGCCCGCTCATTATGCACGCGGTAGTTGCGGTGTGTACTCGGTCGATAAAGTCACT
GGCTGGCAGCCAGGCGGCTTGGGTTATCAGCACTATGTGCCCTTTGAGTCGTTTGAACACGATTCTGCTG
TCAGCGTGAAAAGTGACTCGCCTTACTACAGCGTCAGGCACCGGGCTTCCCTGCAACACAGCGGTCTTGA
CACTTTCCTGAGCTTCGATCTGCGTGCGGAACGGGCGCGTGAGACGGTGTCCATCGAGTTGACGTGCACC
AATGATGAACTTCCGCAAAAGATCAGCGTGGGTGGCATATGCAAGTCGTGTGACGGCACCCCTGATTTCT
TGCGCTTTAAAAACATAATGCCCGCCACGCGAAGTTTCGCGCCGCCCATGACGCGAGATTTCCTTTGGCG
CGTCATCAGTAACATGTCGTTGAATTATTTGTCGCTGGCCAATATTGAAGCATTGAAAGTCATTCTCGAA
ACCTATGACTTGCCCCGGTATTACGATCCGAGGGCGGAGAAAGTCAGTCAGCACCTGTTAAAGGGGTTGA
AATCCATACGTCATCAACCCGTCGATCGTCTGCATAACGGTCGGCCGGTAAGGGGCGTGAAGACCGAGTT
GACGGTCCAGCCTGACGGTTTTACAGGGGAGGGCAGCCTTTTCCTGTTTGCTTCTGTCCTGAACGAGTTC
TTCGCGCTGTACGCGAGCCTGAATTCTTTTCATGAACTGCACGTCACGAGCACACAGGGTGGAGGCTACC
AATGGAAACCACGGATGGGGCAGCAACCGCTGCTCTGA