SecReT6
Protein ID: 28869738
SecReT6 ID41
T6SS typei1
Gene symbol-
Locus tagPSPTO_2547
StrainPseudomonas syringae pv. tomato str. DC3000
Repliconchromosome [GenBank: NC_004578] [Browse all T6SS(s) in this replicon]
Location [Strand]2811942..2812949 [+]
Producthypothetical protein
NoteTssG
UniProt IDQ882S8
KEGG IDpst:PSPTO_2547
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 1.20E-84, Aligned region: 18..321
Protein Sequence: 335 a.a.     [Download]
>gi|28869738|ref|NP_792357.1| unnamed protein product [Pseudomonas syringae pv. tomato str. DC3000]
METTDGAATAALNALCHDIREYSIYQAIPLILQMLRGIHPDADDQGIHDFLELRANPGLGFPGSDIDCMA
LFYEQGHVHVRLDLNVMSLTGSGSPLPAFYAEQALEDRDKPNTTRDFVDIFNHRLQKLMVPVWRKYRYHA
AFTTGATDPFSEQLFALIGLHGERIRETTELNWKRLLPYLGLLSLRAHSAALIESVLRYYFKHAQLFIEQ
CVERTVDITPPQLNRLGRANSRLAYDAVLGSRVPDRGGKFRIHIKQLDWKRFHEFLPIGPDYPPLGALVR
FTLRDPLDYDVCLELVHEDIRDLRIGQSNACRLGWTSWLGREHALGLVTLNRPTH
 
Nucleotide Sequence: 1008 bp     [Download]
>gi|28867243|ref|NC_004578.1|:2811942-2812949 Pseudomonas syringae pv. tomato str. DC3000 chromosome, complete genome
ATGGAAACCACGGATGGGGCAGCAACCGCTGCTCTGAACGCGCTGTGTCATGACATCAGGGAATATTCGA
TTTATCAGGCCATCCCGCTGATTTTGCAAATGCTGCGTGGGATTCACCCTGATGCCGATGATCAGGGGAT
TCATGACTTTCTCGAACTGCGGGCCAACCCCGGCCTCGGGTTCCCGGGCAGCGATATTGACTGCATGGCG
CTTTTTTACGAGCAGGGTCATGTGCATGTACGACTGGATCTCAATGTCATGAGCTTGACTGGATCAGGGT
CCCCGTTGCCTGCTTTTTACGCCGAGCAAGCACTGGAAGACCGAGACAAGCCCAATACCACGCGAGACTT
TGTCGATATTTTCAATCACCGCTTACAAAAACTGATGGTGCCTGTATGGCGCAAGTATCGCTATCACGCA
GCGTTTACCACCGGCGCAACCGATCCATTTTCCGAGCAACTGTTCGCCCTGATCGGTTTGCATGGGGAGC
GCATTCGCGAAACTACCGAGTTGAACTGGAAGCGGTTATTGCCCTATCTCGGGTTGTTGAGCTTGCGTGC
GCATTCTGCTGCGCTGATTGAATCGGTGCTTCGTTACTACTTCAAGCACGCACAATTATTCATTGAGCAG
TGCGTTGAGCGAACGGTTGACATAACTCCTCCGCAACTCAACCGCCTCGGAAGAGCCAATAGCCGGTTAG
CGTATGACGCAGTGCTGGGCAGCCGGGTTCCTGATCGGGGCGGCAAGTTTCGTATTCACATAAAACAGCT
CGACTGGAAGCGTTTCCACGAGTTTCTGCCCATTGGCCCTGATTACCCGCCACTGGGTGCGCTCGTGCGG
TTCACCTTGCGCGACCCGCTGGATTACGACGTCTGTCTTGAGCTTGTGCATGAAGACATCAGAGATTTGC
GCATCGGCCAATCAAACGCGTGTCGCCTCGGCTGGACCAGTTGGTTAGGGCGCGAGCACGCCTTGGGCCT
CGTGACGCTCAACAGACCGACTCATTAA