SecReT6
Protein ID: 28869739
SecReT6 ID41
T6SS typei1
Gene symbol-
Locus tagPSPTO_2548
StrainPseudomonas syringae pv. tomato str. DC3000
Repliconchromosome [GenBank: NC_004578] [Browse all T6SS(s) in this replicon]
Location [Strand]2812959..2815562 [+]
ProductclpB protein
NoteTssH
UniProt IDQ882S7
KEGG IDpst:PSPTO_2548
PDB IDNA
Domain hit(s) vs Pfam AAA_2 [PF07724], Evalue: 9.50E-42, Aligned region: 206..308
AAA_2 [PF07724], Evalue: 9.50E-42, Aligned region: 601..766
AAA [PF00004], Evalue: 1.40E-18, Aligned region: 208..339
AAA [PF00004], Evalue: 1.40E-18, Aligned region: 606..728
AAA_5 [PF07728], Evalue: 1.60E-11, Aligned region: 208..228
AAA_5 [PF07728], Evalue: 1.60E-11, Aligned region: 425..502
AAA_5 [PF07728], Evalue: 1.60E-11, Aligned region: 605..720
ClpB_D2-small [PF10431], Evalue: 4.20E-11, Aligned region: 424..454
ClpB_D2-small [PF10431], Evalue: 4.20E-11, Aligned region: 777..848
AAA_16 [PF13191], Evalue: 6.50E-09, Aligned region: 186..227
AAA_16 [PF13191], Evalue: 6.50E-09, Aligned region: 252..286
AAA_16 [PF13191], Evalue: 6.50E-09, Aligned region: 585..641
AAA_16 [PF13191], Evalue: 6.50E-09, Aligned region: 670..699
AAA_22 [PF13401], Evalue: 2.00E-08, Aligned region: 163..206
AAA_22 [PF13401], Evalue: 2.00E-08, Aligned region: 207..294
AAA_22 [PF13401], Evalue: 2.00E-08, Aligned region: 428..428
AAA_22 [PF13401], Evalue: 2.00E-08, Aligned region: 603..710
AAA_17 [PF13207], Evalue: 2.80E-06, Aligned region: 208..257
AAA_17 [PF13207], Evalue: 2.80E-06, Aligned region: 604..640
AAA_19 [PF13245], Evalue: 1.40E-05, Aligned region: 205..228
AAA_19 [PF13245], Evalue: 1.40E-05, Aligned region: 598..627
Sigma54_activat [PF00158], Evalue: 1.60E-05, Aligned region: 204..222
Sigma54_activat [PF00158], Evalue: 1.60E-05, Aligned region: 604..722
IstB_IS21 [PF01695], Evalue: 1.90E-05, Aligned region: 202..232
IstB_IS21 [PF01695], Evalue: 1.90E-05, Aligned region: 605..623
AAA_18 [PF13238], Evalue: 8.00E-05, Aligned region: 208..242
AAA_18 [PF13238], Evalue: 8.00E-05, Aligned region: 363..385
AAA_18 [PF13238], Evalue: 8.00E-05, Aligned region: 606..645
AAA_25 [PF13481], Evalue: 0.00013, Aligned region: 208..232
AAA_25 [PF13481], Evalue: 0.00013, Aligned region: 601..637
AAA_29 [PF13555], Evalue: 0.00019, Aligned region: 202..224
AAA_29 [PF13555], Evalue: 0.00019, Aligned region: 600..630
NACHT [PF05729], Evalue: 0.00058, Aligned region: 208..235
NACHT [PF05729], Evalue: 0.00058, Aligned region: 493..569
NACHT [PF05729], Evalue: 0.00058, Aligned region: 605..631
DUF258 [PF03193], Evalue: 0.0014, Aligned region: 175..225
DUF258 [PF03193], Evalue: 0.0014, Aligned region: 603..617
ResIII [PF04851], Evalue: 0.0042, Aligned region: 192..230
ResIII [PF04851], Evalue: 0.0042, Aligned region: 278..290
ResIII [PF04851], Evalue: 0.0042, Aligned region: 577..633
Protein Sequence: 867 a.a.     [Download]
>gi|28869739|ref|NP_792358.1| unnamed protein product [Pseudomonas syringae pv. tomato str. DC3000]
MIDVDLQQLVKALDAPTRNELEGAAGRCVSRGSSQILVEDMLPGLLERPDGMLMRALSDADVSTAEFAGL
ILVPVEHSVDRTPVFAAELVQWFQDALLIATLDLGQSHIDQAALILALLRNPLRYADRPYQPLLAKINIE
RFRDYVLSRQASGTARQAIHQSDSLLERFTHNLTQQAREGSLDPVLCRDDCLRQMVDILARRRKNNPIVV
GEAGVGKTAIVEGLALRIVRGEVPDLLKDVELLSLDMGLLQAGASIKGEFERRLKGVIDEVKSSPGSFIL
FIDEAHTLIGAGANAGGSDAANILKPALARGELRTIAATTWAEYRQYFEKDPALARRFQPVRVLEPTVEQ
AVTILRGLAPLYEQSHGVYLRDDAVVAAARLSARYISGRQLPDKAIDLLDTACARVQISLVAVPERLEHL
RSEMVQQQRHLEAVQRDADAGLSVDDKVLSTLASSVSRIRKEAIVLEDAWLDQRKTARRVLDLRQQLAHR
KIQQNALTTLDSDCQATQALESELAQAQQTILSTQLKDRLVSFEVCPRLVAQVVNAWTGIPLSQLVQEHS
LSIADFSSDLRLRIRGQEQAVQVLERAVKASAAGLNAPNAPTGVFLLVGPSGVGKTETAIALADLLYGGE
RFLTTINMSEFQEKHTVSRLIGAPAGYVGYGEGGMLTDAVRQKPYSVILLDEVEKADPEVMNLFYQIFDK
GVANDGEGREINFRNTLILMTSNLGGDLIHASCREGERPDADELAMRIKPLLTAHFKPALLARMRVVPYY
PVTGVVLHELIELKLSRLGERLECRGLTFSYSPDLTRYLLECCTQSDSGARLIDHVLESRVTPLIADRLL
SAASSGDSVSRAHATLDASGGIVCEFE
 
Nucleotide Sequence: 2604 bp     [Download]
>gi|28867243|ref|NC_004578.1|:2812959-2815562 Pseudomonas syringae pv. tomato str. DC3000 chromosome, complete genome
ATGATCGATGTAGACCTGCAGCAACTCGTTAAAGCCCTGGATGCCCCCACACGCAACGAACTCGAGGGGG
CCGCAGGGCGTTGCGTGTCCAGAGGCAGTAGCCAGATTCTCGTTGAGGATATGTTGCCTGGCTTGCTGGA
ACGACCGGATGGAATGCTGATGCGTGCGCTATCGGACGCAGATGTCTCGACTGCCGAATTCGCAGGCCTG
ATCCTTGTGCCTGTTGAGCATAGCGTCGACCGAACCCCGGTATTCGCCGCCGAACTTGTTCAATGGTTTC
AGGACGCACTTCTTATTGCCACGCTGGATTTGGGGCAGAGTCACATTGATCAGGCTGCGCTGATTCTTGC
GCTGCTGCGCAACCCGTTGCGTTATGCCGATCGTCCCTACCAGCCACTCCTGGCGAAAATCAACATTGAA
CGCTTTCGGGACTATGTGCTTTCCAGGCAGGCATCCGGCACAGCAAGGCAAGCGATACATCAATCTGATT
CACTGCTCGAACGCTTCACTCATAACCTGACGCAGCAGGCCCGAGAGGGGTCGCTTGATCCGGTGCTGTG
CCGGGACGACTGCCTGCGGCAGATGGTCGACATACTGGCTCGCCGCCGCAAGAACAATCCGATTGTGGTG
GGCGAGGCGGGTGTTGGCAAAACTGCAATTGTCGAAGGGCTGGCGCTGAGAATCGTTCGGGGTGAAGTTC
CTGACCTATTGAAAGATGTCGAACTGTTGTCTCTTGATATGGGCCTGCTCCAGGCAGGTGCCAGTATCAA
AGGCGAGTTCGAGCGTCGCTTGAAGGGCGTCATTGACGAGGTCAAGTCTTCGCCGGGCTCTTTCATTCTG
TTCATTGATGAAGCCCACACTCTGATCGGCGCAGGTGCAAATGCTGGAGGCTCAGACGCTGCCAACATTT
TGAAGCCAGCACTGGCACGTGGCGAACTGCGCACTATCGCGGCAACCACCTGGGCCGAATATCGACAATA
CTTTGAGAAGGATCCGGCGCTTGCACGTCGCTTTCAGCCGGTTCGCGTGCTTGAGCCCACGGTCGAACAA
GCCGTCACCATCCTGCGCGGGCTCGCTCCACTGTATGAACAGAGCCATGGCGTCTATCTACGCGACGATG
CGGTGGTGGCCGCTGCCCGGCTGTCGGCACGCTATATATCCGGTCGGCAGCTGCCAGACAAGGCAATCGA
TCTGCTTGATACAGCCTGCGCCCGAGTGCAAATCAGTCTGGTCGCGGTGCCTGAGCGCCTTGAGCATCTT
CGCAGCGAGATGGTTCAGCAGCAGAGACACCTTGAGGCCGTGCAGCGTGATGCCGATGCAGGCTTGTCGG
TGGATGACAAGGTGTTGAGTACACTGGCATCCAGTGTGTCGCGTATCCGCAAGGAAGCCATCGTGCTTGA
AGACGCCTGGCTTGATCAGCGAAAAACCGCCAGGCGGGTGCTTGATCTGCGTCAGCAACTTGCCCACCGA
AAAATACAGCAGAACGCTCTGACCACTCTGGACAGTGATTGTCAGGCCACCCAGGCGCTGGAGTCCGAAT
TGGCTCAGGCTCAGCAGACGATCCTCAGCACGCAGCTGAAAGACCGTCTGGTGAGCTTCGAAGTATGTCC
CAGGTTAGTCGCGCAAGTGGTCAATGCCTGGACCGGCATACCGCTGTCGCAGCTGGTCCAGGAACACAGC
CTTTCCATTGCAGATTTTTCGTCTGACCTGCGTCTGCGCATTCGGGGACAGGAGCAGGCTGTGCAGGTTC
TTGAAAGGGCAGTGAAGGCGTCGGCGGCAGGTTTGAATGCGCCGAATGCACCTACTGGCGTGTTCCTTCT
GGTGGGTCCCAGTGGCGTGGGCAAGACCGAAACCGCTATCGCTCTGGCTGATCTTTTATATGGCGGCGAG
CGCTTTCTTACGACGATCAATATGTCCGAGTTTCAGGAAAAGCATACGGTCTCACGCTTGATCGGCGCGC
CTGCGGGCTACGTTGGCTATGGCGAGGGAGGCATGTTGACCGATGCCGTTCGACAGAAGCCGTACTCGGT
GATTCTGCTTGATGAAGTCGAGAAGGCTGACCCGGAAGTAATGAACCTGTTCTATCAGATATTCGACAAG
GGTGTCGCCAACGACGGCGAAGGCCGGGAAATCAACTTCCGCAACACGCTTATTCTGATGACTTCCAATC
TGGGCGGTGATCTGATCCATGCGAGCTGCCGAGAGGGTGAGCGTCCGGATGCCGACGAGCTGGCTATGAG
AATAAAGCCGCTACTCACCGCGCATTTCAAGCCTGCTTTACTGGCCAGGATGCGAGTAGTGCCTTATTAC
CCCGTTACGGGGGTGGTGCTCCATGAATTGATCGAGTTGAAACTGAGCAGGCTTGGGGAAAGGCTCGAAT
GCCGCGGGCTGACCTTCAGTTATTCTCCGGATCTGACTCGCTATCTGCTTGAATGCTGCACCCAAAGCGA
CAGCGGTGCGAGGTTGATTGATCACGTGCTGGAGTCACGCGTGACGCCGCTCATCGCCGACCGACTGCTG
AGTGCCGCGAGCAGCGGTGACAGCGTCTCCAGGGCGCACGCAACACTTGACGCTTCTGGCGGCATTGTCT
GTGAGTTCGAATAA