SecReT6
Protein ID: 28869742
SecReT6 ID41
T6SS typei1
Gene symbol-
Locus tagPSPTO_2551
StrainPseudomonas syringae pv. tomato str. DC3000
Repliconchromosome [GenBank: NC_004578] [Browse all T6SS(s) in this replicon]
Location [Strand]2817337..2817828 [+]
Producthypothetical protein
NoteTssJ
UniProt IDQ882S4
KEGG IDpst:PSPTO_2551
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 1.50E-39, Aligned region: 14..150
Protein Sequence: 163 a.a.     [Download]
>gi|28869742|ref|NP_792361.1| unnamed protein product [Pseudomonas syringae pv. tomato str. DC3000]
MIFYCTRLARLLLLLTLAGCSALSPYSTQTRLDITLRADHQLNPDLNGRPSPVVLKLLELKRPVTFQSMD
FFSLYQRTDHVMEQDLVASEEFELRPGESIALKLKLEEGSRYVGLLAAYRNLPETRWRHVIQIIPEQQNH
AAFILGESGIQRVDSPISAGNPT
 
Nucleotide Sequence: 492 bp     [Download]
>gi|28867243|ref|NC_004578.1|:2817337-2817828 Pseudomonas syringae pv. tomato str. DC3000 chromosome, complete genome
ATGATTTTTTATTGCACCCGGCTGGCCCGGTTACTGCTGTTGCTCACGCTCGCCGGTTGCTCAGCGCTTT
CGCCATACTCTACACAAACCCGTCTGGATATCACGCTACGCGCGGACCATCAGCTCAATCCGGATTTGAA
TGGCCGGCCGTCTCCAGTTGTTCTGAAACTGCTGGAACTCAAACGTCCGGTCACGTTTCAATCGATGGAT
TTCTTTTCACTGTATCAGCGTACGGATCACGTAATGGAGCAAGACCTTGTCGCAAGCGAAGAGTTTGAGC
TTCGTCCCGGCGAGAGCATTGCATTGAAGCTGAAACTGGAAGAGGGCAGTCGTTACGTCGGCCTGTTGGC
GGCTTATCGCAACCTGCCGGAGACCCGCTGGCGTCATGTGATTCAGATAATCCCCGAACAACAGAATCAT
GCTGCTTTCATCCTGGGTGAGTCTGGCATCCAGCGAGTCGACAGCCCGATCAGCGCAGGAAATCCCACAT
GA