SecReT6
Protein ID: 28869743
SecReT6 ID41
T6SS typei1
Gene symbol-
Locus tagPSPTO_2552
StrainPseudomonas syringae pv. tomato str. DC3000
Repliconchromosome [GenBank: NC_004578] [Browse all T6SS(s) in this replicon]
Location [Strand]2817858..2819156 [+]
Producthypothetical protein
NoteTssK
UniProt IDQ882S3
KEGG IDpst:PSPTO_2552
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 2.70E-135, Aligned region: 7..431
Protein Sequence: 432 a.a.     [Download]
>gi|28869743|ref|NP_792362.1| unnamed protein product [Pseudomonas syringae pv. tomato str. DC3000]
MLLRPQHFQHNDRYYDHQLKVRTRLAGAFNWGFTALEIDRQFLSSGQIVLNQASGIFPDGSVFDIGDRER
PLALDIAPNTSNLSVYVALPIVAGNCIEARSQEQSDVFARFTAYAASVADSNAGEGSSTPVVCARPEFRL
LLGEPQGEHTYVMLKLCHILICSPDKAITLDAEYSATFVNAGGSRYLMSCLKEVTSLLQHRGDVIAARIS
SRGQASDAEVGDFMMLQLINRSALVLRHYLETRHLHPEELYRLLLTLLGELATFGTETRRPRLESSYQHT
DQAATFRSVMLAIRQLLSMVVEQHALELELQPRQYGVLVSPRIDGELLGTASFVLAARAQCDAEELRVRL
PSHLKVGSVESIRELVALHLPGIRLRPLPVAPRQIPFHANKTYFVLDINDQEQIGIDKSGGFAFHVSGEF
SGLELQFWAIRN
 
Nucleotide Sequence: 1299 bp     [Download]
>gi|28867243|ref|NC_004578.1|:2817858-2819156 Pseudomonas syringae pv. tomato str. DC3000 chromosome, complete genome
ATGCTGCTGCGTCCGCAGCACTTTCAGCATAACGACCGTTATTACGATCATCAGTTGAAAGTCCGTACCC
GTCTGGCGGGGGCCTTCAACTGGGGGTTCACGGCGCTGGAAATTGATCGGCAATTTCTGAGCTCTGGGCA
GATTGTGCTTAACCAGGCCTCGGGCATATTCCCGGATGGCAGCGTCTTCGATATCGGTGACCGTGAGCGT
CCATTGGCGCTGGATATTGCGCCCAACACTTCAAACCTGTCGGTCTATGTAGCACTGCCGATCGTAGCGG
GTAATTGCATCGAGGCACGCAGCCAGGAACAGTCGGATGTGTTCGCGCGTTTCACCGCCTACGCCGCCAG
CGTCGCGGATTCCAACGCTGGAGAGGGCAGTTCCACACCGGTTGTCTGCGCGCGCCCCGAGTTTCGTCTG
CTGCTGGGTGAACCACAAGGCGAGCACACCTACGTGATGCTCAAGTTGTGCCATATCCTGATCTGCAGCC
CTGACAAGGCAATAACACTGGACGCTGAATACTCTGCCACATTCGTCAATGCCGGCGGTTCCCGGTACTT
GATGTCGTGCCTGAAGGAGGTCACAAGCCTGTTGCAGCACCGAGGCGATGTCATTGCTGCGCGCATCAGT
TCGCGCGGCCAGGCCAGCGATGCCGAGGTGGGTGATTTCATGATGTTGCAATTGATCAATCGCAGTGCGT
TGGTGCTTCGGCACTATCTGGAGACTCGACATCTTCACCCTGAAGAGCTGTATCGCTTATTGCTGACGCT
ACTGGGTGAGCTGGCGACGTTTGGCACTGAAACAAGGCGCCCTCGACTGGAAAGCAGCTACCAACATACA
GATCAGGCGGCGACGTTCAGGAGTGTGATGCTTGCCATTCGACAATTGTTGTCGATGGTCGTTGAACAGC
ATGCGCTGGAACTCGAGTTGCAGCCCAGGCAGTACGGTGTGTTGGTTTCTCCTCGCATCGACGGTGAGCT
GCTGGGAACCGCCTCATTTGTGCTGGCTGCCCGCGCGCAATGCGATGCCGAAGAACTGCGCGTTCGATTG
CCGTCGCACCTCAAGGTCGGTTCTGTGGAGAGTATCCGTGAACTGGTAGCGTTGCATCTTCCCGGTATCA
GGCTCAGGCCGCTGCCCGTGGCACCCCGACAGATCCCGTTTCATGCCAACAAGACTTACTTCGTTCTCGA
CATCAACGATCAGGAGCAGATTGGAATCGATAAGTCCGGAGGGTTCGCCTTTCATGTGTCAGGCGAGTTC
TCGGGGCTTGAATTGCAGTTTTGGGCGATCAGAAACTGA